Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
LGALS14 antibody
LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
ALOX15 antibody
ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLPurity:Min. 95%BD1 antibody
BD1 antibody was raised in rabbit using highly pure recombinant human BD-1 as the immunogen.
Purity:Min. 95%Podoplanin antibody
Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.
HIV1 antibody (HTLV3)
HIV1 antibody (HTLV3) was raised in goat using human isolate as the immunogen.Purity:Min. 95%S6K1 antibody
The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this
Purity:Min. 95%cSRC antibody
The cSRC antibody is a valuable tool in the field of Life Sciences. It is widely used as an inhibitor for 6-phosphogluconate dehydrogenase, an enzyme involved in glucose metabolism. This antibody specifically targets and binds to the phosphorylation site of cSRC, a protein kinase that plays a crucial role in cell signaling pathways.
Purity:Min. 95%CEP55 antibody
CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
PPP1R12A antibody
PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen
KIAA0859 antibody
KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
ADAR1 antibody
The ADAR1 antibody is a reactive growth factor that is commonly used in Life Sciences research. It has the ability to bind to lipoprotein lipase and serum albumin, forming a disulfide bond. This specific monoclonal antibody is highly effective in detecting autoantibodies and can be used for various applications in research and diagnostics. Additionally, it has shown binding affinity towards cations and anti-thyroglobulin antibodies. With its high specificity and sensitivity, the ADAR1 antibody is an essential tool for studying protein-protein interactions and understanding disease mechanisms.
CD45R antibody (Spectral Red)
CD45R antibody (PE) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molDDOST antibody
DDOST antibody was raised using the N terminal of DDOST corresponding to a region with amino acids SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD
ZNF605 antibody
ZNF605 antibody was raised in rabbit using the N terminal of ZNF605 as the immunogen
Purity:Min. 95%MDFIC antibody
MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen
Purity:Min. 95%Parathyroid Hormone antibody
The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.
SEPN1 antibody
SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen
Purity:Min. 95%OR6C70 antibody
OR6C70 antibody was raised using the C terminal of OR6C70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK
NEDD1 antibody
NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV
MTCH2 antibody
MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
IGFBP3 antibody
The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.
Purity:Min. 95%
