Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CD33 antibody
CD33 antibody was raised in Mouse using a purified recombinant fragment of CD33(48-258) expressed in E. coli as the immunogen.FAM98A antibody
FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG
LZTFL1 antibody
LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
GFPT2 antibody
GFPT2 antibody was raised in rabbit using the N terminal of GFPT2 as the immunogen
Purity:Min. 95%Protein S antibody
Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.Purity:Min. 95%RARA antibody
The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.
DPYS antibody
DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID
Podoplanin antibody
Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.
Influenza B antibody
Influenza B antibody was raised in goat using the yamagata strain of influenza B as the immunogen.Purity:Min. 95%RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purity:Min. 95%PSMC4 antibody
The PSMC4 antibody is a highly specialized antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied for its potential applications in cancer research and therapy.
SLC5A4 antibody
SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
Factor VIII antibody (biotin)
Factor VIII antibody (biotin) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.ABCB1 antibody
ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%PRMT5 antibody
The PRMT5 antibody is a highly effective inhibitor that specifically targets protein kinase activity. This monoclonal antibody has been extensively tested and validated by Life Sciences experts to ensure its efficacy. It can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.
Integrin Beta 5 antibody
Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALPurity:Min. 95%Parathyroid Hormone antibody
The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.
CRP antibody
CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.
AF594 Donkey anti Goat IgG (H + L)
Donkey anti Goat IgG (Heavy + Light chain) secondary antibody with AF594 photostable fluorescent dye label. Minimal cross-reaction with Human, Mouse, Chicken, Rabbit, Guniea Pig, Syrian Hamster, Horse, Rat. Lyophilized from 0.01M Na3PO4, 0.25M NaCl, pH 7.6, with 15mg/ml BSA, and 0.05% NaN3. Reconstitute with 0.4 ml of distilled Water.Purity:Min. 95%Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.
Rabbit anti Human IgG (Texas Red)
Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%RLBP1L1 antibody
RLBP1L1 antibody was raised using the middle region of RLBP1L1 corresponding to a region with amino acids MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT
PSMD4 antibody
The PSMD4 antibody is a neutralizing monoclonal antibody that targets antiphospholipid antibodies. It is used as a test substance in various research applications, including in vitro and in vivo studies. This antibody specifically binds to the PSMD4 protein, which is an essential component of the 26S proteasome. The PSMD4 antibody has been shown to effectively neutralize the activity of autoantibodies, preventing their harmful effects on cells and tissues. It can be used in immunoassays to detect the presence of PSMD4 or as a tool for studying its function and interactions with other molecules. With its high specificity and affinity for PSMD4, this monoclonal antibody is a valuable resource for researchers in the field of Life Sciences.
S6K1 antibody
The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this
Purity:Min. 95%ILK antibody
The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.
CD209 antibody
The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.
Purity:Min. 95%PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
HES2 antibody
The HES2 antibody is a polyclonal antibody that specifically targets the serum albumin protein. It has cytotoxic properties and is widely used in Life Sciences research. The HES2 antibody has been shown to interact with various proteins, including angptl3, e-cadherin, taxol, β-catenin, and osteopontin. It is commonly used in experiments involving hybridization and activated human serum. This antibody is highly effective in detecting and analyzing specific proteins in biological samples, making it an essential tool for researchers in various fields.
DGKE antibody
DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRPurity:Min. 95%RAB39A antibody
The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.
HSPA4 antibody
HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
