Primary Antibodies

<p>The Keratin 7 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. This antibody specifically targets the tyrosine residues on Keratin 7, which is a protein found in the epithelial cells of various tissues. By binding to these residues, the Keratin 7 antibody promotes cell growth and differentiation.</p>

<p>FUS antibody was raised using the N terminal of FUS corresponding to a region with amino acids MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY</p>

<p>GNPTAB antibody was raised in rabbit using the N terminal of GNPTAB as the immunogen</p>

<p>UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA</p>

<p>Purified Polyclonal IL37 antibody</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>Rabbit polyclonal LN28A antibody</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>Mouse monoclonal SEC14L2 antibody</p>

<p>Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.</p>

<p>The XPA antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to XPA, a protein involved in DNA repair. This antibody has been widely used in studies investigating the role of XPA in various cellular processes, including DNA damage response and repair mechanisms. The XPA antibody has shown high specificity and sensitivity in detecting XPA protein levels in human serum samples. It has also been used to study the interaction between XPA and other proteins, such as taxol, atrial natriuretic peptide, and growth factors. Additionally, this antibody has been used in the development of nanocomposites for drug delivery systems and as a tool for neutralizing specific proteins in monoclonal antibody-based therapies.</p>

<p>HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD</p>

<p>XAB2 antibody was raised in rabbit using the C terminal of XAB2 as the immunogen</p>

<p>The Caspase 1 antibody is a highly reactive monoclonal antibody that specifically targets caspase 1, an enzyme involved in inflammatory responses and programmed cell death. This antibody is widely used in life sciences research to study the role of caspase 1 in various biological processes, including adipose tissue inflammation, cancer development, and immune response modulation.</p>

<p>The Rb antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be an invaluable tool in studying different cellular pathways. This monoclonal antibody specifically targets the Rb protein, which is involved in regulating cell growth and division. By binding to the Rb protein, this antibody allows researchers to study its function and explore its potential as a therapeutic target.</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR</p>

<p>Rabbit polyclonal TROVE2 antibody</p>

<p>SIRT4 antibody was raised in rabbit using the N terminal of SIRT4 as the immunogen</p>

<p>Rat monoclonal CD147 antibody (PE)</p>

<p>The LTA4H antibody is a monoclonal antibody that specifically targets the antigen LTA4H. It is colloidal in nature and belongs to the class of monoclonal antibodies. This antibody has been widely used in various applications in the field of Life Sciences, including immunoassays and research studies. The LTA4H antibody has shown high specificity and sensitivity in detecting LTA4H, making it a valuable tool for researchers studying this antigen. It can be used in experiments involving carbon quantum dots, steroids, collagen, ketamine, and other related compounds. Additionally, this antibody can also be utilized for the detection of autoantibodies or as a therapeutic agent targeting specific diseases. The LTA4H antibody is supplied in a buffered solution to ensure stability and optimal performance.</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>Purified Rabbit polyclonal PUB72 antibody</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Purified Polyclonal Delta Opioid Receptor antibody</p>

<p>Rabbit polyclonal PRKAG1 antibody</p>

<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>

<p>Rabbit polyclonal ERP29 antibody (HRP)</p>

<p>The bRAF antibody is a highly reactive and immobilizing antibody that is used in Life Sciences research. It is capable of neutralizing the binding proteins associated with bRAF, an important protein involved in cell signaling pathways. This antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence. The bRAF antibody has been shown to be effective in detecting the presence of bRAF in human serum samples and mesenchymal stem cells. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the best option for their specific needs. With its high specificity and affinity, the bRAF antibody provides accurate and reliable results for a wide range of experiments.</p>

<p>Rabbit polyclonal ACSL6 antibody</p>

<p>RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ</p>

<p>SMYD3 antibody was raised in rabbit using the C terminal of SMYD3 as the immunogen</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>ZGPAT antibody was raised using the middle region of ZGPAT corresponding to a region with amino acids LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS</p>

<p>The Cytochrome P450 2D6 antibody is a polyclonal antibody that specifically targets and binds to the cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism, particularly in the metabolism of many commonly prescribed medications. The antibody recognizes the specific amino acid sequence of the cytochrome P450 2D6 enzyme and can be used for various applications in life sciences research.</p>

<p>The NANP antibody is a monoclonal antibody that targets myostatin, a protein involved in muscle growth regulation. This antibody specifically binds to myostatin and inhibits its activity, leading to increased muscle mass and strength. In addition to its effects on myostatin, the NANP antibody has been shown to interact with other proteins such as elastase and lipoprotein lipase. These interactions may have implications for various biological processes, including fibrinogen metabolism and lipid metabolism. The NANP antibody is widely used in life sciences research and has applications in areas such as drug discovery, diagnostics, and therapeutics. Its specificity and high affinity make it a valuable tool for studying the role of myostatin in muscle development and disease.</p>

<p>TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL</p>

<p>B4GALNT3 antibody was raised using the N terminal of B4GALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA</p>

<p>ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDR</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>The Ezrin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to ezrin, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathways, particularly endothelial growth factor (EGF). By blocking EGF signaling, the Ezrin antibody can prevent the proliferation and migration of cells, making it an ideal choice for research and therapeutic applications.</p>

<p>Purified Polyclonal BCLW antibody</p>

<p>The TCTP antibody is a biochemical agent that targets the hyperpolarization-activated protein kinase. It belongs to the group of polyclonal antibodies and can be used for various applications, including research and diagnostic purposes. This antibody specifically recognizes TCTP (Translationally Controlled Tumor Protein), which has been found to play a role in various cellular processes such as cell growth, proliferation, and apoptosis.</p>

<p>Rabbit polyclonal RAB9A antibody</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>Purified Polyclonal STAM2 antibody</p>

<p>The FKBPL antibody is a high-quality polyclonal antibody that is colloidal in nature. It specifically targets the thioredoxin interacting protein (FKBPL) and forms a strong disulfide bond with it. This antibody is widely used in life sciences research for various applications, including the study of reactive growth factors and biomolecules. It can also be used as a drug antibody or diagnostic reagent due to its high specificity and affinity for FKBPL. Additionally, this antibody has shown promising results in collagen-related research and can be used in electrode-based assays. For researchers looking for a reliable monoclonal antibody, the FKBPL antibody is an excellent choice. Its effectiveness against TGF-beta makes it an essential tool for studying this important signaling pathway.</p>

<p>The MCL1 antibody is a glycoprotein that plays a crucial role in cell survival and apoptosis regulation. It is involved in the binding of activated Bcl-2 family proteins, which control the intrinsic pathway of apoptosis. This antibody is commonly used in various assays and research studies to detect and quantify MCL1 expression levels.</p>

<p>The hnRNP L Antibody is a highly specific monoclonal antibody that is widely used in life sciences research. This cytotoxic antibody targets hnRNP L, a nuclear protein involved in various cellular processes such as RNA splicing, transport, and stability. The hnRNP L Antibody has been extensively validated for use in assays such as immunofluorescence, immunohistochemistry, and western blotting. It provides reliable and reproducible results, making it an essential tool for researchers studying the role of hnRNP L in gene expression regulation and other molecular mechanisms. With its high affinity and specificity, this monoclonal antibody offers exceptional sensitivity and accuracy in detecting hnRNP L in various biological samples. Whether you are investigating myostatin signaling pathways or exploring the functions of fibrinogen or lipoprotein lipase, the hnRNP L Antibody is an indispensable tool for your research needs. Trust this reliable antibody to provide accurate and consistent results that will advance your</p>

<p>Rabbit polyclonal MOL1A antibody</p>