Primary Antibodies

<p>Rabbit polyclonal PFDN4 antibody</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>

<p>WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Mouse monoclonal HAG2 antibody</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>NFYA antibody was raised in Rabbit using Human NFYA as the immunogen</p>

<p>MAOA antibody was raised in Rabbit using Human MAOA as the immunogen</p>

<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>

<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

<p>The RAN antibody is a powerful tool used in Life Sciences research. It is an alpha-fetoprotein antibody that specifically targets and binds to the RAN protein. This monoclonal antibody can be conjugated with various compounds, such as tyrosine or cytotoxic agents, to enhance its therapeutic potential. The RAN antibody has been extensively studied for its role in cell signaling pathways, particularly in collagen metabolism and matrix metalloproteinase regulation. Additionally, it has shown promising results in inhibiting tumor growth and metastasis. This highly specific antibody can also be used in diagnostic applications, such as detecting the presence of RAN protein in patient samples. Researchers and scientists rely on the RAN antibody to gain insights into cellular processes and develop novel therapies for various diseases.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Rabbit polyclonal SERPINB8 antibody</p>

<p>The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.</p>

<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.</p>

<p>INSR antibody was raised in Rabbit using Human INSR as the immunogen</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>HSF4 antibody was raised in Rabbit using Human HSF4 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>LIMA1 antibody was raised in Rabbit using Human LIMA1 as the immunogen</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>Rabbit polyclonal PDCD1 antibody</p>

<p>Rat monoclonal B7RP1 antibody (PE)</p>

<p>Infectious bronchitis virus (IBVD) is an acute, highly contagious upper respiratory tract disease in chickens</p>

<p>MRPL37 antibody was raised in Rabbit using Human MRPL37 as the immunogen</p>

<p>Rabbit polyclonal RSU1 antibody</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>Rabbit polyclonal TROAP antibody</p>

<p>The NANP antibody is a monoclonal antibody that targets myostatin, a protein involved in muscle growth regulation. This antibody specifically binds to myostatin and inhibits its activity, leading to increased muscle mass and strength. In addition to its effects on myostatin, the NANP antibody has been shown to interact with other proteins such as elastase and lipoprotein lipase. These interactions may have implications for various biological processes, including fibrinogen metabolism and lipid metabolism. The NANP antibody is widely used in life sciences research and has applications in areas such as drug discovery, diagnostics, and therapeutics. Its specificity and high affinity make it a valuable tool for studying the role of myostatin in muscle development and disease.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>