Primary Antibodies

<p>Rabbit polyclonal TRAP1 antibody</p>

<p>NFYA antibody was raised in Rabbit using Human NFYA as the immunogen</p>

<p>Anti-Human CD25 Monoclonal Antibody</p>

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>Rabbit polyclonal RAPGEFL1 antibody</p>

<p>Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>The PTPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both a monoclonal and polyclonal antibody. This antibody specifically targets and binds to the PTPN2 protein, which plays a crucial role in various biological processes.</p>

<p>Purified Mouse anti-Human IgG (gamma chain specific) Monoclonal Antibody</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>Affinity Purified Goat anti-Chicken IgY Fc Antibody. Please inquire for bulk pricing or custom conjugations.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Rabbit polyclonal RSPH3 antibody</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>The CYP2J2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that specifically targets the CYP2J2 enzyme, which plays a crucial role in the metabolism of arachidonic acid. This antibody has high bioavailability and can effectively neutralize the activity of CYP2J2.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>Affinity Purified Donkey anti-Sheep IgG h+l Antibody</p>

<p>Rabbit polyclonal PDCD1 antibody</p>

<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>The TFCP2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the transcription factor CP2 (TFCP2) and is commonly used to study its role in various cellular processes. This antibody has been shown to effectively detect TFCP2 in different experimental settings, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>

<p>MAST1 antibody was raised in Rabbit using Human MAST1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>Rabbit polyclonal TFDP1 antibody</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>

<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>

<p>LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV</p>

<p>The RAN antibody is a powerful tool used in Life Sciences research. It is an alpha-fetoprotein antibody that specifically targets and binds to the RAN protein. This monoclonal antibody can be conjugated with various compounds, such as tyrosine or cytotoxic agents, to enhance its therapeutic potential. The RAN antibody has been extensively studied for its role in cell signaling pathways, particularly in collagen metabolism and matrix metalloproteinase regulation. Additionally, it has shown promising results in inhibiting tumor growth and metastasis. This highly specific antibody can also be used in diagnostic applications, such as detecting the presence of RAN protein in patient samples. Researchers and scientists rely on the RAN antibody to gain insights into cellular processes and develop novel therapies for various diseases.</p>

<p>Rabbit polyclonal TMLHE antibody</p>