Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
GRK6 antibody
The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.
PLXDC1 antibody
The PLXDC1 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been extensively studied for its role in endothelial growth and angiogenesis. This antibody specifically targets PLXDC1, a receptor that plays a crucial role in regulating the growth and development of blood vessels.
AGXT2L1 antibody
AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT
NSE antibody
The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.
TGFB3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Additionally, this drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
Mouse RBC antibody (Texas Red)
Mouse RBC antibody (Texas Red) was raised in rabbit using mouse erythrocytes as the immunogen.
PSAP antibody
The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
PARP2 antibody
The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.
RASGRP4 antibody
The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.
Pneumocystis carinii antibody
Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.
JAK1 antibody
The JAK1 antibody is a highly effective chemokine inhibitor that has cytotoxic properties. It works by binding to the glucagon acid complex, preventing the activation of receptors and inhibiting cell signaling. This monoclonal antibody is specifically designed to target JAK1, a key protein involved in immune response and inflammation. By blocking the receptor binding, it prevents the release of pro-inflammatory cytokines and reduces inflammation in various tissues. The JAK1 antibody is widely used in life sciences research and has shown promising results in treating autoimmune diseases and certain types of cancer. Its high specificity and affinity make it an excellent tool for studying protein-protein interactions and developing targeted therapies.
BLyS antibody
BLyS antibody was raised in mouse using recombinant human BLyS (134-285aa) purified from E. coli as the immunogen.RAP1GDS1 antibody
The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.
STK17A antibody
STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)
Fos antibody
The Fos antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear protein Fos, which plays a crucial role in cellular processes such as glucose transporter regulation and growth factor signaling. This antibody is commonly used to study thrombotic microangiopathy, a condition characterized by abnormal clot formation in small blood vessels. By binding to Fos, the antibody allows researchers to visualize and analyze the activation of this important protein. In addition to its use in research, there are also polyclonal antibodies available for detecting other components of the actin filaments, such as phalloidin or actin itself. These antibodies are valuable tools for studying atypical hemolytic disorders and other conditions involving actin dynamics. With their high specificity and sensitivity, these antibodies provide researchers with reliable results for their experiments.
MTIF3 antibody
MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Donkey anti-Mouse IgG (H+L) biotin
Donkey ant-mouse IgG (H + L) secondary antibody biotinPurity:Min. 95%CKMM antibody
CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.VAMP5 antibody
VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Rat Thrombocyte antibody
Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.
Purity:Min. 95%TACC3 antibody
The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.
LIMK1 antibody
The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.
P38 MAPK antibody
The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.
Purity:Min. 95%Mouse anti Human Kappa Light Chain antibody
Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.
Human Serum Albumin antibody
Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.
HIV1 antibody (HTLV3) (FITC)
HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.
Chromogranin A antibody
Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.
