Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
NRIP1 antibody
NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)GRK6 antibody
The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.
EEF2 antibody
The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.
RAVER2 antibody
RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL
JMJD5 antibody
JMJD5 antibody was raised in rabbit using the middle region of JMJD5 as the immunogen
Purity:Min. 95%GRPEL1 antibody
GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
NSUN4 antibody
NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
Goat anti Llama IgG (H + L) (HRP)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.Purity:Min. 95%JAK2 antibody
JAK2 antibody was raised in Mouse using a purified recombinant fragment of JAK2(745-955aa) expressed in E. coli as the immunogen.
OR13C9 antibody
OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen
Purity:Min. 95%ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
PDIA4 antibody
The PDIA4 antibody is a highly specialized product in the field of Life Sciences. It possesses unique characteristics that make it a valuable tool for various applications. This monoclonal antibody has been developed to target and neutralize the activity of PDIA4, a protein kinase involved in important cellular processes.
Tau antibody
The Tau antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Tau proteins. Tau proteins play a crucial role in maintaining the structure and function of nerve cells in the brain. However, in certain neurodegenerative diseases such as Alzheimer's disease, these proteins become abnormally phosphorylated and form tangles, leading to cognitive decline.
PYK2 antibody
The PYK2 antibody is a highly specific monoclonal antibody that targets PYK2, a tyrosine kinase protein involved in various cellular processes. This antibody has been extensively tested and validated for its ability to neutralize the activity of PYK2, making it an invaluable tool for researchers studying signal transduction pathways and cell signaling mechanisms. The PYK2 antibody can be used in a variety of applications, including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry. It is available as both a purified monoclonal antibody and as part of a kit that includes all the necessary reagents for successful experiments. With its high specificity and sensitivity, the PYK2 antibody is an essential tool for any researcher working with PYK2-related studies.
NFS1 antibody
NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
WDR5 antibody
WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen
Purity:Min. 95%FAM98A antibody
FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG
Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.
Purity:Min. 95%AFP antibody
The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.
Complement C2 antibody
Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Purity:Min. 95%Borrelia burgdorferi antibody
Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Purity:Min. 95%MVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
Goat anti Human kappa chain (HRP)
This antibody reacts with kappa light chains on human immunoglobulins.Purity:Min. 95%ATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Influenza A antibody (FITC)
Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.
Purity:Min. 95%Rabbit anti Goat IgG (H + L) (FITC)
Rabbit anti-goat IgG (H+L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%
