Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
IFITM1 antibody
The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.
GLUT4 antibody
The GLUT4 antibody is a polyclonal antibody used in the life sciences field. It specifically targets binding proteins involved in the regulation of glucose transport. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to effectively detect GLUT4 expression in various tissues and cell types.
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
FGF9 antibody
The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.
NR0B1 antibody
NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
FGF1 antibody
The FGF1 antibody is a powerful globulin that acts as a family kinase inhibitor, specifically targeting endothelial growth. This antibody is widely used in the field of Life Sciences and is highly effective in inhibiting cdk4/6, a crucial enzyme involved in cell cycle regulation. Additionally, the FGF1 antibody has shown remarkable neutralizing properties against caspase-9, an enzyme responsible for initiating apoptosis. With its polyclonal nature, this antibody exhibits high specificity and affinity towards alpha-fetoprotein, making it an ideal tool for research involving adipose tissue. Furthermore, the FGF1 antibody has demonstrated antiviral activity and can effectively target molecules associated with viral infections. Its colloidal formulation ensures stability and ease of use. Researchers also utilize this antibody as an anti-VEGF agent due to its ability to counteract vascular endothelial growth factor.
Podoplanin antibody
Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.
STAT3 antibody
The STAT3 antibody is a powerful tool used in life sciences research to study the function and activity of the transcription factor STAT3. This antibody specifically recognizes and binds to the phosphorylated form of STAT3, allowing researchers to investigate its role in various cellular processes. The chromatin immunoprecipitation assay can be performed using this antibody to analyze the DNA binding activity of STAT3 and identify its target genes. Additionally, the STAT3 antibody has been shown to inhibit the growth factor-induced transmembrane conductance in certain cell types. It has also been implicated in neuroprotective effects and plays a crucial role in the regulation of cytokine family signaling pathways, such as interleukin-6. With its high specificity and potency, this polyclonal antibody is an essential tool for scientists studying signal transduction pathways mediated by STAT3.
PGD antibody
The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.
LIF antibody
The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.
CALML3 antibody
CALML3 antibody was raised in rabbit using the middle region of CALML3 as the immunogen
TNFSF15 antibody
TNFSF15 antibody is a polyclonal antibody that targets TNFSF15, a member of the tumor necrosis factor (TNF) ligand superfamily. It plays a crucial role in immune regulation and inflammation. This antibody can bind to TNFSF15 and inhibit its activity, preventing it from binding to its receptor and initiating downstream signaling pathways. TNFSF15 antibody has been shown to have lysis activity against target cells expressing TNFSF15, making it a potential therapeutic option for conditions associated with TNFSF15 overexpression. Additionally, this antibody can be used in research applications such as western blotting, immunohistochemistry, and flow cytometry to detect and quantify TNFSF15 expression levels. With its high specificity and sensitivity, TNFSF15 antibody is a valuable tool for studying the function of TNFSF15 in various biological processes.
CD70 antibody
The CD70 antibody is a potent antitumor agent that has been shown to inhibit the growth of tumors by reducing microvessel density and suppressing endothelial cell growth. This monoclonal antibody specifically targets the CD70 receptor, which is overexpressed in various cancer cells. By binding to this receptor, the CD70 antibody exerts cytotoxic effects on tumor cells, leading to their destruction.
PPP1R9B antibody
The PPP1R9B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein PPP1R9B, also known as neurabin-2 or spinophilin. This antibody is commonly used in various applications, including immunohistochemistry, western blotting, and ELISA assays.
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
