Primary Antibodies

Purified Polyclonal MCT8 antibody

The RXRB antibody is a monoclonal antibody that targets the retinoid X receptor beta (RXRB). This receptor is involved in various cellular processes, including growth and development. The RXRB antibody has been shown to have cytotoxic effects on cancer cells, particularly in HL-60 cells. It binds to specific binding proteins and inhibits the activity of tumor necrosis factor-alpha (TNF-α) and vascular endothelial growth factor (VEGF), which are important factors in cancer progression. Additionally, the RXRB antibody has been found to have anti-glycation properties and may play a role in regulating hormone peptides. In the field of Life Sciences, this antibody is widely used for research purposes, including studying signal transduction pathways and developing targeted therapies. It is also being investigated as a potential family kinase inhibitor and an anti-CD33 antibody for the treatment of certain types of leukemia.

Rabbit polyclonal SMPX antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, which ultimately inhibits bacterial growth. Its efficacy has been demonstrated through various scientific techniques such as transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.