Primary Antibodies

NQO1 antibody was raised in rabbit using the C terminal of NQO1 as the immunogen

Affinity purified Rabbit polyclonal LOC169436 antibody

The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.

Affinity purified Rabbit polyclonal FLJ32786 antibody

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.

DDIT4L antibody was raised in Rabbit using Human DDIT4L as the immunogen

The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.

The STEAP1 antibody is a highly specialized antibody that targets the phosphatase STEAP1. This antibody has cytotoxic properties and has been shown to disrupt actin filaments, leading to cell death. It is available as both polyclonal and monoclonal antibodies, offering researchers a range of options for their experiments. In the field of Life Sciences, this antibody is widely used for its neutralizing effects on STEAP1 activity. The monoclonal antibody variant has been specifically designed to be activated upon binding to STEAP1, ensuring optimal performance in immunoassays. With its high affinity and specificity, this antibody can be used in various applications such as Western blotting, immunofluorescence, and flow cytometry. Researchers can rely on the STEAP1 antibody to accurately detect and measure the levels of this important glycoprotein in their experiments.

Affinity purified Rabbit polyclonal DNAJB2 antibody

alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids  VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Affinity purified Rabbit polyclonal KPNA4 antibody

CTSL2 antibody was raised in Rabbit using Human CTSL2 as the immunogen

The PTGER1 antibody is a highly specialized polyclonal antibody that is designed to specifically target and bind to the PTGER1 antigen. This antibody is widely used in research and life sciences applications, particularly in the study of alpha-synuclein and its role in various diseases and conditions. The PTGER1 antibody has been shown to have a high affinity for the PTGER1 antigen, making it an ideal tool for detecting and quantifying the presence of this protein in samples. Additionally, this antibody has been extensively validated for use in techniques such as immunohistochemistry, immunofluorescence, and Western blotting. Its exceptional specificity ensures reliable and accurate results, making it an invaluable asset for researchers working in the fields of neuroscience, cell biology, and molecular biology. With its ability to provide detailed insights into the expression patterns and localization of PTGER1, this antibody opens up new avenues for understanding the complex mechanisms underlying various diseases and holds great promise for future therapeutic development.

The XIAP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to X-linked inhibitor of apoptosis protein (XIAP), a glycoprotein that plays a crucial role in cell survival and death pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.

The SAMHD1 antibody is a neuroprotective globulin that is used in the field of Life Sciences. It is a monoclonal antibody that targets SAMHD1, an inhibitory factor involved in various cellular processes. This antibody has been shown to neutralize the activity of SAMHD1 and has potential applications in research and therapeutic development. The SAMHD1 antibody is highly specific and exhibits high affinity for its target. It can be used in various assays, including immunohistochemistry, Western blotting, and flow cytometry. This product is available as a monoclonal antibody with excipients to ensure stability and long shelf life. The SAMHD1 antibody is glycosylated, which enhances its binding efficiency and overall performance. With its unique properties, this antibody offers great potential for advancing scientific discoveries in the field of neuroprotection and beyond.

NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids  PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

The ATM antibody is a highly specialized monoclonal antibody that has been designed to target and bind to the ATM protein. This protein plays a crucial role in the DNA damage response pathway and is involved in cell cycle regulation, DNA repair, and apoptosis. The ATM antibody can be used in various research applications, including molecular docking studies, immunoassays, and hybridization experiments. It has been shown to specifically recognize and form a complex with the epidermal growth factor (EGF)-like domain of the ATM protein. Additionally, the ATM antibody exhibits high affinity for albumin, a major component of human serum. Its unique binding properties make it an invaluable tool for scientists working in the field of life sciences who are studying cellular processes related to DNA damage and repair.

Rabbit polyclonal RRAGA antibody (biotin)

GEMIN4 antibody was raised in Rabbit using Human GEMIN4 as the immunogen

Affinity purified Rabbit polyclonal ARL4A antibody

IL7 antibody is a highly specific antibody that targets interleukin-7 (IL-7), a cytokine involved in the regulation of immune cell development and function. This antibody is widely used in Life Sciences research, particularly in studies related to immunology and inflammation. IL7 antibody is commonly used for various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.

Protein C antibody is a valuable tool in Life Sciences research. It is an antibody that specifically targets and binds to Protein C, an important protein involved in the anticoagulant pathway. This antibody can be used for various applications, including studying the role of Protein C in coagulation processes, investigating its glycosylation patterns, and exploring its interactions with other molecules such as fibrinogen.

The TOP2B antibody is a polyclonal antibody that targets the topoisomerase II beta (TOP2B) enzyme. This enzyme plays a crucial role in DNA replication and repair, making it an important target for research in the field of life sciences. The TOP2B antibody has been shown to be effective in neutralizing the activity of TOP2B, inhibiting its function and preventing DNA damage.

ATP6V0D1 antibody was raised in Rabbit using Human ATP6V0D1 as the immunogen

Affinity purified Rabbit polyclonal NAT1 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Affinity purified Rabbit polyclonal SLC25A13 antibody

Rabbit polyclonal CRBP III antibody

The MMACHC antibody is a monoclonal antibody that targets oncostatin and e-cadherin expression. It is commonly used in Life Sciences research to study the role of these proteins in various cellular processes. This antibody specifically binds to e-cadherin, a protein involved in cell adhesion and tissue integrity. By targeting e-cadherin, the MMACHC antibody can provide valuable insights into cell signaling pathways and cellular interactions. Additionally, this antibody has been shown to be effective in detecting osteopontin, a protein associated with bone remodeling and cancer metastasis. The MMACHC antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying protein-protein interactions and cellular mechanisms.

Rabbit polyclonal PKLR antibody

Rabbit polyclonal GRIN2C antibody

Affinity purified Rabbit polyclonal HLADMB antibody

C1QTNF3 antibody was raised in Rabbit using Human C1QTNF3 as the immunogen

Rabbit polyclonal SQLE antibody

CPA5 antibody was raised in Rabbit using Human CPA5 as the immunogen

Affinity purified Rabbit polyclonal BBS7 antibody

Affinity purified Rabbit polyclonal p21 ARC antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.