Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Alkaline Phosphatase antibody
The Alkaline Phosphatase antibody is a monoclonal antibody that targets the alkaline phosphatase enzyme. It has been widely used in the field of Life Sciences for various applications. This antibody specifically binds to alkaline phosphatase and inhibits its activity, making it a valuable tool for studying the function of this enzyme.IL1b antibody
The IL1b antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to interleukin 1 beta (IL-1β), a glycosylated glycoprotein involved in inflammatory responses. This antibody is widely used in studies related to autoimmune diseases, cancer, and immune system disorders.
CD23 antibody
CD23 antibody is a monoclonal antibody that specifically targets the CD23 protein, a molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study the function and regulation of CD23. It can be used to detect and quantify CD23 expression levels in cells or tissues, providing valuable insights into its role in different physiological and pathological conditions. Additionally, CD23 antibody has been shown to inhibit the activity of derivatives such as ferritin and fibrinogen, suggesting its potential therapeutic applications in oxidative damage and inflammatory disorders. Furthermore, this antibody has been found to modulate hepatocyte growth factor and collagen synthesis, indicating its involvement in tissue repair and regeneration processes. With its high specificity and versatility, CD23 antibody is an indispensable tool for researchers studying various aspects of cellular signaling pathways and molecular interactions involving CD23.
PRSS16 antibody
PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
Purity:Min. 95%Influenza A antibody (FITC)
Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.
Purity:Min. 95%LTBR antibody
The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.
PDGFRB antibody
PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%PRKAA2 antibody
PRKAA2 antibody was raised using the middle region of PRKAA2 corresponding to a region with amino acids AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
Myc antibody
The Myc antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor interleukin-6 (IL-6). IL-6 is known to play a crucial role in various biological processes, including cell proliferation and cytotoxicity. By specifically binding to IL-6, the Myc antibody effectively inhibits its activity, preventing excessive cell growth and promoting a balanced cellular environment.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
