Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
PPEF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
CD25 antibody (Azide Free)
CD25 antibody (Azide free) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell as the immunogen.
GluR1 antibody
The GluR1 antibody is a monoclonal antibody that specifically targets the GluR1 subunit of the glutamate receptor. This antibody is widely used in Life Sciences research to study the role of GluR1 in various cellular processes. It has been shown to inhibit the activity of GluR1, leading to a decrease in tyrosine phosphorylation and subsequent downstream signaling events. Additionally, the GluR1 antibody has neutralizing properties against tumor necrosis factor-alpha (TNF-α), epidermal growth factor (EGF), and other growth factors. It can also be used as an inhibitor of lipoprotein lipase and anti-HER2 antibody. With its high specificity and potent inhibitory effects, the GluR1 antibody is an invaluable tool for researchers studying cellular signaling and related pathways.
Purity:Min. 95%anti-Canine Parvovirus Antibody
Canine parvovirus (CPV) is a highly contagious viral infection that affects dogs, especially puppies and young dogs. The virus belongs to the Parvoviridae family and is closely related to feline panleukopenia virus (FPV), which affects cats.;This Monoclonal anti-Canine Parvovirus antibody is suitable for ELISA and LFD applications. Suggest using as capture antibody in LFD format.Purity:Min. 95%SERPINA1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
GJA9 antibody
GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
Purity:Min. 95%Rabbit anti Guinea Pig IgG (H + L) (FITC)
This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.
Purity:Min. 95%SAA4 antibody
SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF
Purity:Min. 95%HAV VP3 antibody
The HAV VP3 antibody is a monoclonal antibody that has neutralizing properties. It belongs to the class of antibodies known as monoclonal antibodies, which are specifically designed to target and neutralize specific antigens. This antibody is particularly effective in neutralizing the hepatitis A virus (HAV) by binding to its VP3 protein component.BBS5 antibody
BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
Ankyrin repeat domain 45 antibody
Affinity purified Rabbit polyclonal Ankyrin repeat domain 45 antibody
TRIM33 antibody
The TRIM33 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to TRIM33 protein, which plays a crucial role in cellular processes. The antibody is made using advanced techniques and high-quality materials to ensure its effectiveness.
Goat anti Human IgM (mu chain) (rhodamine)
This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.Purity:Min. 95%Lamin Type A and C antibody
Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.
Streptococcus Group A antibody (biotin)
Streptococcus group A antibody (biotin) was raised in rabbit using group A Streptococci as the immunogen.
Purity:Min. 95%Goat anti Mouse IgM (mu chain)
This antibody reacts with heavy (mu) chains on mouse IgM.
Purity:Min. 95%Glutamate receptor 2 antibody
The Glutamate receptor 2 antibody is a highly reactive monoclonal antibody that is used in life sciences research. It specifically targets the glutamate receptors present in various protein isoforms. The antibody works by binding to the receptors and disrupting protein-protein interactions, thus inhibiting the activation of colony-stimulating factors. This leads to a reduction in cytotoxic effects and promotes the pluripotency of cells. The Glutamate receptor 2 antibody is produced using recombinant vaccinia technology, ensuring high purity and specificity. Additionally, it forms a stable disulfide bond with its target, resulting in long-lasting and reliable results. Researchers can rely on this monoclonal antibody for accurate detection and analysis of β-catenin signaling pathways.
Purity:Min. 95%ALDH3B1 antibody
ALDH3B1 antibody was raised using the N terminal of ALDH3B1 corresponding to a region with amino acids DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD
UCHL5IP antibody
UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
gp340 antibody
The gp340 antibody is a highly specialized monoclonal antibody that is designed to target and neutralize specific proteins in the body. It has been extensively tested and proven effective in various research studies conducted by Life Sciences professionals. This antibody specifically targets influenza hemagglutinin, a protein that plays a crucial role in the growth and spread of the influenza virus.
CCR6 antibody
The CCR6 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets and binds to the CCR6 protein, which plays a crucial role in various biological processes. The CCR6 antibody can be used for research purposes such as studying the activation of growth factors and tyrosine kinase receptors. It has also been shown to have cytotoxic effects, making it a potential candidate for antibody-drug conjugates.
Cyclin D1 antibody
The Cyclin D1 antibody is a globulin-based neutralizing antibody that specifically targets Cyclin D1, a protein involved in cell cycle regulation. This antibody has been extensively studied and proven to effectively inhibit the activity of Cyclin D1, making it a valuable tool for research purposes.
Goat anti Bovine IgG (H + L) (FITC)
Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.
Purity:Min. 95%Loricrin antibody
Loricrin antibody was raised using the N terminal of LOR corresponding to a region with amino acids GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSG
Haptoglobin antibody
Haptoglobin antibody was raised in goat using human haptoglobin as the immunogen.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
