Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
CCL11 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.
Cox2 antibody
The Cox2 antibody is a growth factor that targets a specific cell antigen known as endothelial growth. It belongs to the category of polyclonal antibodies and is widely used in the field of Life Sciences. This antibody has been shown to have interactions with various proteins, including fibrinogen, lipoprotein lipase, and amyloid plaque. Additionally, it can inhibit the activity of lipase and phosphatase enzymes. The Cox2 antibody is available in both polyclonal and monoclonal forms, making it suitable for different research purposes. It is often used to detect autoantibodies or as a tool for studying triglyceride lipase activity. With its versatile applications, this antibody is an essential tool for researchers in various fields.
VEGFD antibody
The VEGFD antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitor against TGF-β1 and chemokine, making it an essential component in various research studies. This monoclonal antibody has shown inhibitory properties against protein kinase, insulin, and natriuretic factors. Its unique design allows for precise targeting and binding to specific molecules, ensuring accurate results in immunoassays. With its ability to neutralize interferon activity, the VEGFD antibody opens up new possibilities for studying neurotrophic factors and their role in different biological processes. Researchers can rely on this high-quality antibody to enhance their experiments and gain valuable insights into cellular mechanisms.
Cytokeratin 10 antibody
Cytokeratin 10 antibody is a monoclonal antibody that specifically targets and binds to cytokeratin 10, a protein found in epithelial cells. This antibody is commonly used in life sciences research to study the expression and localization of cytokeratin 10 in various tissues and cell types. Cytokeratin 10 plays a crucial role in maintaining the structural integrity of epithelial cells and is involved in cell adhesion, migration, and differentiation processes. By targeting cytokeratin 10, this antibody enables researchers to gain valuable insights into the cellular mechanisms underlying tissue development, wound healing, and diseases such as cancer. With its high specificity and sensitivity, the cytokeratin 10 antibody is an essential tool for scientists investigating the complex functions of epithelial cells in both normal and pathological conditions.
Endoglin antibody
Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ
EMR1 antibody
The EMR1 antibody is a polyclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, an important neurotransmitter in the human body. This antibody has been shown to have high affinity and specificity for its target, making it an effective tool for researchers studying glutamate-related processes.
GMCSF antibody
The GMCSF antibody is a highly specialized protein used in the field of Life Sciences. It is commonly used in research and diagnostic applications. This antibody plays a crucial role in regulating the growth and development of various cells in the body, including white blood cells.
PUMA antibody
The PUMA antibody is a powerful tool in the field of Life Sciences. It is an autoantibody that specifically targets and neutralizes the activity of PUMA (p53 upregulated modulator of apoptosis) protein. PUMA plays a crucial role in regulating cell death and is involved in various physiological processes, including embryonic development, tissue homeostasis, and immune response.
CAD antibody
The CAD antibody is a monoclonal antibody that specifically targets fatty acid and protein biomarkers. It is commonly used in immunoassay tests to detect the presence of these biomarkers in various samples. The reactive nature of this antibody makes it a potential biomarker for research in the Life Sciences field.
Connexin 43 antibody
Connexin 43 antibody is a glycoprotein that plays a crucial role in cell communication. It is commonly used in life sciences research as a tool to study the function of connexin proteins. This polyclonal antibody specifically targets connexin 43, which is one of the most abundant connexin isoforms found in various tissues and organs.
DLST antibody
The DLST antibody is a highly specialized product that is essential for various research and laboratory applications in the field of Life Sciences. This antibody specifically binds to DLST, which stands for Dihydrolipoamide S-Succinyltransferase, an important enzyme involved in cellular metabolism.
SAP130 antibody
The SAP130 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This antibody specifically targets the SAP130 protein, which is involved in the regulation of gene expression and chromatin remodeling. By binding to SAP130, this antibody can modulate the activity of calmodulin, an important calcium-binding protein.
AQP3 antibody
The AQP3 antibody is a spectrometric monoclonal antibody that is used in Life Sciences research. It specifically targets the aquaporin-3 (AQP3) protein, which plays a crucial role in water and glycerol transport across cell membranes. This antibody has been extensively studied and validated for its ability to detect AQP3 in various samples, including human serum.
ROCK1 antibody
The ROCK1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the ROCK1 protein, which plays a crucial role in cell migration, adhesion, and contraction. By inhibiting the activity of ROCK1, this antibody can help researchers study the function of this protein and its involvement in various cellular processes.
KLRG1 antibody
The KLRG1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and inhibit the proteolytic activity of KLRG1, a protein involved in cell cytotoxicity. This antibody specifically binds to KLRG1, preventing its interaction with other proteins and inhibiting its function.
GFAP antibody
GFAP antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets glial fibrillary acidic protein (GFAP), which is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody recognizes and binds to GFAP, allowing researchers to study the expression and localization of this protein.
RNPEPL1 antibody
RNPEPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD
BPGM antibody
The BPGM antibody is a powerful tool used in chemotherapy and various Life Sciences research applications. It belongs to the class of antibodies that specifically target BPGM (bisphosphoglycerate mutase), an enzyme involved in the metabolism of glucose. This antibody has high affinity for BPGM and can be used in various assays to detect its presence or measure its activity.
CBG antibody
The CBG antibody is a highly specialized antibody-drug that belongs to the class of polyclonal antibodies. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets insulin-like growth factor and thrombocytopenia, making it a valuable tool for researchers studying these areas.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
