Primary Antibodies

The TRIM46 antibody is a highly specialized antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various applications within the field of Life Sciences. This monoclonal antibody has the ability to neutralize certain proteins, such as epidermal growth factor, collagen, and angptl3. By targeting these proteins, it can inhibit their activity and prevent unwanted cellular responses.

The PCBP2 antibody is a polyclonal antibody that specifically targets the PCBP2 protein. This protein plays a crucial role in various biological processes, including regulation of insulin production and growth factor signaling. The PCBP2 antibody is widely used in life sciences research to study the function and expression of PCBP2.

Rabbit polyclonal CKMT antibody (FITC)

Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.

Enterovirus antibody is a biomolecule that specifically targets the glycoprotein of enteroviruses. It is a monoclonal antibody that has been shown to have neutralizing properties against enteroviruses, preventing their ability to infect host cells. This antibody is widely used in Life Sciences research to study the mechanisms of enterovirus infection and develop potential antiviral therapies. Additionally, Enterovirus antibody can be used in diagnostic assays to detect the presence of enteroviruses in patient samples. Its high specificity and sensitivity make it a valuable tool for detecting and studying these viral infections.

MDR1 antibody is a chemokine that belongs to the group of polyclonal antibodies. It targets the MDR1 protein, also known as P-glycoprotein, which plays a crucial role in multidrug resistance in cancer cells. The MDR1 antibody can be used for various applications, including telomerase detection, microsphere-based immunoassays, and helicobacter pylori diagnosis. It can also be used to detect autoantibodies and colloidal gold-labeled antibodies. Additionally, the MDR1 antibody has been shown to have anti-connexin agent activity and can inhibit annexin binding. It can be used as a substrate for siRNA delivery or as a monoclonal antibody for macrophage inflammatory response studies. The MDR1 antibody is an essential tool for researchers studying phosphorylcholine antigens and their interactions with immune cells.

MYBL2 antibody was raised in Rabbit using Human MYBL2 as the immunogen

Rabbit polyclonal PDHX antibody

COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen

MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST

GLRA1 antibody was raised in rabbit using the middle region of GLRA1 as the immunogen

The Cytoglobin antibody is a polyclonal antibody that has been developed to target the Cytoglobin protein. This protein is involved in various biological processes, including cell growth and differentiation. The antibody can be used in research studies to investigate the role of Cytoglobin in different cellular pathways.

E. coli antibody was raised in goat using a mixture of E. coli serotypes as the immunogen.

ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR

The FHL2 antibody is a polyclonal antibody that specifically targets hepatocyte growth factor (HGF), a potent growth factor involved in various biological processes. This antibody can be used for immobilization or activation of HGF in different experimental setups. It is also available as a monoclonal antibody, which offers high specificity and reproducibility. The FHL2 antibody has been shown to have cytotoxic effects on certain cancer cell lines, making it a valuable tool in cancer research. Additionally, this antibody can neutralize the activity of angptl3, a glycoprotein involved in lipid metabolism. Its ability to function at low pH levels further enhances its versatility in various life science applications.

CENPO antibody was raised in Rabbit using Human CENPO as the immunogen

Mouse monoclonal C17orf28 antibody

The ALK antibody is a highly effective multidrug that is commonly used in immunoassays. This monoclonal antibody specifically targets the epidermal growth factor and histidine receptors, making it a versatile tool for various applications. The ALK antibody has been extensively studied and has shown excellent results in chemokine and cytotoxic assays, as well as in the detection of growth factors. It can be used in conjunction with other Polyclonal Antibodies to enhance its efficacy. The ALK antibody is activated upon binding to its target, allowing for accurate and reliable results. It is also compatible with ophthalmic formulations and can be used in colloidal or phosphatase-based assays. With its high specificity and sensitivity, the ALK antibody is an essential tool for researchers and clinicians alike.

Affinity purified Rabbit polyclonal LARS2 antibody

Affinity purified Rabbit polyclonal beta Tubulin 8 antibody

LAT2 antibody was raised in Rabbit using Human LAT2 as the immunogen

The CD55 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, a key molecule involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the treatment of HER2-positive cancers.

ADAP2 antibody was raised in Rabbit using Human ADAP2 as the immunogen

Affinity purified Rabbit polyclonal DUSP7 antibody

Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.

The CMTM6 antibody is a hormone peptide that binds to specific proteins in the body. It is a powerful tool for researchers and healthcare professionals working in the field of hormone regulation. This antibody has been extensively studied and proven to be effective in various applications.

The COX2 antibody is a powerful tool used in immunoassay tests to detect the presence of cyclooxygenase-2 (COX-2) protein. This polyclonal antibody is produced by hybridoma cells and has high specificity for COX-2. It has been extensively tested and validated for use in various applications, including western blotting, immunohistochemistry, and flow cytometry.

HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

Affinity purified Rabbit polyclonal CAMK1D antibody

Affinity purified Rabbit polyclonal GLE1 antibody

Affinity purified Rabbit polyclonal ASB9 antibody

Affinity purified Rabbit polyclonal PRPSAP2 antibody

The CD44 antibody is a powerful tool used in Life Sciences research. It belongs to the category of anti-ICOS antibodies and is widely used in various applications. This antibody specifically targets CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion, migration, and signaling.

NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

The Tenascin antibody is a highly specialized recombinant protein that belongs to the class of chemokines. It is designed to target specific antigens and has been extensively studied in the field of Life Sciences. This antibody exhibits strong binding affinity towards glycoproteins, making it an ideal tool for research purposes. It has also been used in studies related to hyperammonemia and shows promising results in inhibiting the growth of cancer cells, such as MCF-7. The Tenascin antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its ability to effectively neutralize target proteins, this antibody holds great potential for therapeutic applications, including the development of antibody-drug conjugates. Whether you're conducting cutting-edge research or exploring new avenues in drug discovery, the Tenascin antibody is a valuable tool that can significantly contribute to your scientific endeavors.

OPRK1 antibody was raised in rabbit using the N terminal of OPRK1 as the immunogen

The KLK7 antibody is a highly potent and specific monoclonal antibody that targets the KLK7 antigen. It has been widely used in Life Sciences research for its ability to detect and immobilize KLK7 in various applications. This antibody binds to KLK7 with high affinity, allowing for accurate and reliable detection of this protein. Additionally, the KLK7 antibody has been shown to have minimal cross-reactivity with other proteins, ensuring precise and specific results. It is commonly used in studies involving actin filaments, atypical hemolytic disorders, and nuclear localization of proteins. The KLK7 antibody is available in both purified and conjugated forms, making it versatile for a wide range of experimental needs. With its exceptional sensitivity and specificity, this antibody is an essential tool for researchers in the field of Life Sciences.

Rabbit polyclonal NRBP2 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.