Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Desmoglein 2 antibody
Desmoglein 2 antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor Desmoglein 2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of Desmoglein 2. By blocking the action of this growth factor, Desmoglein 2 antibody can potentially prevent or reduce the proliferation of cells that are dependent on its signaling pathway.
IBSP antibody
IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE
N Cadherin antibody
The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.
K2 antibody
The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.
RG9MTD2 antibody
RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.Goat anti-Human IgG antibody
The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.
SLC12A2 antibody
SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
STK11 antibody
STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
Complement factor H antibody
The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.
EGF antibody
The EGF antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF), a key regulator of cell growth and division. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of EGF and its downstream signaling pathways.
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
FGF9 antibody
The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.
COX2 antibody
The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.
CHAT antibody
The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.
C Peptide antibody
C Peptide antibody was raised in mouse using human C-peptide-BSA as the immunogen.Purity:>95% Pure By Sds-PageHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
