Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Desmoglein 2 antibody
Desmoglein 2 antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor Desmoglein 2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of Desmoglein 2. By blocking the action of this growth factor, Desmoglein 2 antibody can potentially prevent or reduce the proliferation of cells that are dependent on its signaling pathway.
CSB antibody
CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.
SGSH antibody
The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.
KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
TNFSF10 antibody
TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen
THBS2 antibody
The THBS2 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to CD33, a receptor protein involved in various biological processes. It can be used for research purposes, such as studying receptor binding and identifying binding proteins. Additionally, the THBS2 antibody has applications in diagnostics and therapeutics.
Goat anti human IgG
Goat anti human IgG is a highly effective inhibitor that targets antibodies, specifically sorafenib, in human serum. It has been extensively studied and proven to be effective in various applications, including electrochemical impedance in Life Sciences and immunoassays. This inhibitor works by blocking the activity of phosphatase, preventing the dephosphorylation of target proteins. Additionally, it can be used as a solubilizing agent for monoclonal antibodies, ensuring their stability and functionality. Goat anti human IgG is commonly used in research laboratories and pharmaceutical industries due to its high specificity and reliability. With its ability to bind to glycoproteins and induce fas-mediated apoptosis, this product offers a wide range of possibilities for experimental studies and therapeutic applications.
Factor VII antibody (FITC)
Factor VII antibody (FITC) was raised in sheep using human Factor VII purified from plasma as the immunogen.HLADR antibody
The HLADR antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to the HLADR receptor, which plays a crucial role in immune system function. This antibody has been extensively tested and shown to have high affinity and specificity for its target.
TIMP1 antibody
The TIMP1 antibody is a highly specific and sensitive tool used in Life Sciences research. It is an antibody that specifically targets and binds to TIMP1, which stands for Tissue Inhibitor of Metalloproteinase 1. TIMP1 is a protein that plays a crucial role in regulating the activity of enzymes known as metalloproteinases, which are involved in various biological processes including tissue remodeling, angiogenesis, and cell migration.
IVD antibody
IVD antibody is a reactive growth factor that belongs to the class of monoclonal antibodies. It specifically targets cysteine-rich proteins and can be used to detect autoantibodies in various assays. The IVD antibody has high affinity for tumor necrosis factor-alpha (TNF-α), a glycoprotein involved in inflammation and immune response. This antibody can be used in immunohistochemistry, Western blotting, and other techniques such as electrophoresis to study protein expression and localization. Additionally, the IVD antibody has been shown to modulate transmembrane conductance and act as an angiogenic inducer by targeting chemokines and activated cells. Overall, this versatile monoclonal antibody offers a valuable tool for researchers studying various biological processes and diseases.
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
