Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
CHRNA5 antibody
CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
TMEM59L antibody
TMEM59L antibody was raised using the N terminal of TMEM59L corresponding to a region with amino acids PAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR
SOX13 antibody
The SOX13 antibody is a highly specialized monoclonal antibody that targets the SOX13 protein. This protein is involved in various cellular processes, including nephrotoxicity, fibrinogen production, and regulation of endogenous hematopoietic stem cells. The SOX13 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this protein.
FICD antibody
FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY
ADAMTS4 antibody
The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.
FGF9 antibody
The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.
COX2 antibody
The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.
CHAT antibody
The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.
C Peptide antibody
C Peptide antibody was raised in mouse using human C-peptide-BSA as the immunogen.Purity:>95% Pure By Sds-PageNR0B1 antibody
NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
ApoD antibody
The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.
Enterobacteriaciae Antibody
Mouse anti-Enterobacteriaciae AntibodyPurity:> 90% By Immunoelectrophoresis Using AgaroseRORA antibody
RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS
CLIC4 antibody
CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
PSPH antibody
The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.
CD66b antibody
The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to
SMAD antibody
The SMAD antibody is a highly specific monoclonal antibody that targets the SMAD protein, an important regulator of cellular processes. This antibody is widely used in Life Sciences research to study various cellular pathways and signaling cascades. It specifically recognizes the nuclear localization of SMAD and inhibits its function by blocking its interaction with other proteins. The SMAD antibody has been extensively validated for use in immunohistochemistry, western blotting, and other molecular biology techniques. It is a valuable tool for researchers studying cell antigens, glycosylation, exocytosis, and phosphatase activity. Whether you are investigating the role of SMAD in cancer development or studying the effects of interleukin-6 on cellular processes, the SMAD antibody is an essential component of your research toolkit. Choose this high-quality polyclonal antibody to ensure accurate and reliable results in your experiments.
ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
