Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Glyoxalase I antibody
The Glyoxalase I antibody is a neuroprotective glycosylation inhibitor that targets glycopeptides such as transferrin, insulin, and fibronectin. It is widely used in Life Sciences research to study the role of glycosylation in various biological processes. This polyclonal antibody specifically binds to acidic collagens and has been shown to be effective in detecting antiphospholipid antibodies and autoantibodies. Additionally, it can be used as an insulin antibody for studying insulin signaling pathways. The Glyoxalase I antibody is a valuable tool for researchers investigating glycosylation-related mechanisms and can serve as an anticoagulant in certain applications. With its high specificity and sensitivity, this antibody is an essential component of any laboratory working with Polyclonal Antibodies.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%MGC42174 antibody
MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF
Factor XIIIa antibody
Factor XIIIa antibody is a powerful tool used in Life Sciences research for its ability to target and detect Factor XIIIa, an enzyme involved in blood clot formation. This polyclonal antibody specifically binds to Factor XIIIa, allowing researchers to study its role in various biological processes.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
