Primary Antibodies

The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.

The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.

The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.

ENTPD4 antibody was raised in Rabbit using Human ENTPD4 as the immunogen

MYEF2 antibody was raised in Rabbit using Human MYEF2 as the immunogen

NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids  TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC

Rabbit polyclonal PIGO antibody

KCNIP3 antibody was raised in Rabbit using Human KCNIP3 as the immunogen

Affinity purified Rabbit polyclonal C1orf165 antibody

NDUFA9 antibody was raised in Rabbit using Human NDUFA9 as the immunogen

Affinity purified Rabbit polyclonal BAIAP2L1 antibody

The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.

Affinity purified Rabbit polyclonal FBXL12 antibody

Affinity purified Rabbit polyclonal RBM15 antibody

Affinity purified Rabbit polyclonal Syntrophin alpha 1 antibody

RIPK2 antibody was raised in rabbit using the middle region of RIPK2 as the immunogen

DOK7 antibody was raised in rabbit using the C terminal of DOK7 as the immunogen

RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS

Affinity purified Rabbit polyclonal TNFAP1 antibody

CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.

The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to

The SMAD antibody is a highly specific monoclonal antibody that targets the SMAD protein, an important regulator of cellular processes. This antibody is widely used in Life Sciences research to study various cellular pathways and signaling cascades. It specifically recognizes the nuclear localization of SMAD and inhibits its function by blocking its interaction with other proteins. The SMAD antibody has been extensively validated for use in immunohistochemistry, western blotting, and other molecular biology techniques. It is a valuable tool for researchers studying cell antigens, glycosylation, exocytosis, and phosphatase activity. Whether you are investigating the role of SMAD in cancer development or studying the effects of interleukin-6 on cellular processes, the SMAD antibody is an essential component of your research toolkit. Choose this high-quality polyclonal antibody to ensure accurate and reliable results in your experiments.

MLXIP antibody was raised in Rabbit using Human MLXIP as the immunogen

Affinity purified Rabbit polyclonal Galanin Receptor 2 antibody

ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.

Affinity purified Rabbit polyclonal C20orf11 antibody

HCN3 antibody was raised in Rabbit using Human HCN3 as the immunogen

Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.

Affinity purified Mouse polyclonal GBP1 antibody

Affinity purified Rabbit polyclonal FIG4 antibody

ARHGAP15 antibody was raised in Rabbit using Human ARHGAP15 as the immunogen

The beta Galactosidase antibody is a powerful tool used in various research applications. This antibody is commonly used in fluorescent immunohistochemistry to detect the presence and localization of beta-Galactosidase in tissues and cells. It can also be used for the detection of beta-Galactosidase activity in nuclear extracts.

Affinity purified Rabbit polyclonal PGAM2 antibody

The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.

ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

FOXM1 antibody was raised in rabbit using the N terminal of FOXM1 as the immunogen

The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.