Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
ATF2 antibody
The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.
STAT6 antibody
STAT6 antibody was raised in rabbit using the C terminal of STAT6 as the immunogenPurity:Min. 95%PDE3B antibody
PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNPurity:Min. 95%Acidic hair keratin K32 antibody
acidic hair keratin K32 antibody was raised in Guinea Pig using synthetic peptide of human hair (trichocytic) keratin K32 coupled to KLH as the immunogen.Purity:Min. 95%Anti-PGII antibody
The Anti-PGII antibody is a highly specialized drug antibody that is used in immunoassays within the field of Life Sciences. This antibody specifically targets and neutralizes the effects of PGII, a fatty acid known for its role in adipose tissue. By neutralizing PGII, this antibody helps to regulate viscosity levels and maintain proper adipose function. Additionally, it has been found to have antiestrogen properties and can inhibit the activity of cdk4/6, enzymes involved in cell division. The Anti-PGII antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and offers high specificity and potency in its action. With its ability to target and modulate various biological processes, this antibody holds great promise for research and therapeutic applications within the field of Life Sciences.Purity:≥90% By Sds-PageATP6V1B2 antibody
ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK
PCAF antibody
The PCAF antibody is a monoclonal antibody that specifically targets the amino-terminal region of the PCAF protein. This antibody has been extensively studied and has shown promising results in various applications. It has been found to have neutralizing activity against TNF-α, a key cytokine involved in inflammatory processes. Additionally, the PCAF antibody has been shown to inhibit the formation of dimers of chemokine receptors, which are important for cell migration and activation.
IDH1 antibody
IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
RAB5a antibody
RAB5a antibody was raised in mouse using recombinant human Rab5a (1-215aa) purified from E. coli as the immunogen.
SMP30 antibody
The SMP30 antibody is a polyclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been extensively studied and validated for its use in various applications, including transcription-polymerase chain reaction (PCR) analysis, immunohistochemistry staining, and Western blotting. It shows high specificity and sensitivity in detecting AFP in different samples, such as human serum and tissue sections.
B3GALT1 antibody
B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI
Purity:Min. 95%Histamine H3 Receptor antibody
The Histamine H3 Receptor antibody is a high-quality monoclonal antibody that specifically targets the histamine H3 receptor. This antibody is widely used in life sciences research, including studies on human histamine receptors, egf-like growth factors, and cytotoxic assays. It has been proven to be highly effective in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.
CD154 antibody
The CD154 antibody is a monoclonal antibody that has various biological effects on the immune system. It interacts with CD40, a cell surface receptor, and plays a crucial role in immune responses. The CD154 antibody can stimulate the production of colony-stimulating factors and growth factors, which promote the growth and differentiation of leukocytes. It also enhances the expression of major histocompatibility complex class II molecules, facilitating antigen presentation to T cells. In addition, the CD154 antibody has been shown to inhibit low-density lipoprotein uptake by human serum macrophages. This antibody is widely used in life sciences research, including immunoassays and studies on thrombotic microangiopathy. Its binding to CD40 on human endothelial cells can trigger cellular activation and influence glycoprotein expression. With its diverse functions and applications, the CD154 antibody is an essential tool for understanding immune responses and developing therapeutic strategies in various fields of research.Rabbit anti Dog IgG (H + L)
Rabbit anti-dog IgG (H+L) was raised in rabbit using canine IgG whole molecule as the immunogen.Purity:Min. 95%FAM98A antibody
FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG
Calcitonin antibody
The Calcitonin antibody is an anti-connexin agent that specifically targets transthyretin. It is used for immobilization on electrodes and in interferon assays. This monoclonal antibody has been shown to be highly effective in detecting and quantifying activated tyrosine in human serum, making it a valuable tool in Life Sciences research. With its high specificity and sensitivity, this antibody is widely used in various applications, including antigen detection and characterization. Trust the Calcitonin antibody to deliver accurate and reliable results in your research endeavors.SLC22A1 antibody
SLC22A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
MTAP antibody
The MTAP antibody is a highly specialized product in the field of Life Sciences. It is a nuclear monoclonal antibody that has been developed for various applications, including antinociceptive research. This antibody specifically targets the retinoid-binding protein MTAP, which is found in high levels in certain tissues and cells.
TCP10 antibody
TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH
ATF4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and contains active compounds that effectively inhibit bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
IFNAR2 antibody
IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.
GJB1 antibody
GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Fascin antibody
Fascin antibody is a highly specific monoclonal antibody that targets fascin, a protein involved in cell migration and adhesion. It binds to histidine residues on the fascin molecule, inhibiting its function and preventing tumor metastasis. This antibody has been extensively studied in various research fields, including cancer biology and immunology. Fascin antibody can be used in experiments to detect fascin expression levels in human serum samples or tissue sections. Additionally, it has been shown to have cytotoxic effects on cancer cells and can be used as a therapeutic agent in cancer treatment. The use of this antibody has also been explored in autoimmune diseases, where autoantibodies targeting fascin have been identified. Overall, Fascin antibody is a valuable tool for researchers in the Life Sciences field who are studying cell migration, tumor metastasis, and autoimmunity.
AGT antibody
AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
