Primary Antibodies

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The remarkable potency of this drug has been demonstrated through various scientific techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes several metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture

Affinity purified Rabbit polyclonal ITGA1 antibody

CPEB1 antibody was raised in Rabbit using Human CPEB1 as the immunogen

E2F6 antibody was raised in Rabbit using Human E2F6 as the immunogen

Affinity purified Rabbit polyclonal GLIS1 antibody

PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL

ERCC6 antibody was raised in mouse using recombinant Human Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6 (Ercc6)

VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.

The TRIM9 antibody is a highly specialized polyclonal antibody that targets TNF-α, a key cytokine involved in inflammation and immune response. This antibody is also available in a monoclonal form for specific targeting of TNF-α. It has been shown to have neutralizing properties, effectively blocking the activity of TNF-α and preventing its binding to its receptors.

A2M antibody was raised in Rabbit using Human A2M as the immunogen

DGUOK antibody was raised in Rabbit using Human DGUOK as the immunogen

Rabbit polyclonal THBD antibody

HPDL antibody was raised in Rabbit using Human HPDL as the immunogen

ACP2 antibody was raised in Rabbit using Human ACP2 as the immunogen

Rabbit polyclonal BRCA1 antibody (HRP)

Affinity purified Rabbit polyclonal Phospho-ORF50 antibody

The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.

Rabbit polyclonal Coflin 1 and Cofilin 2 antibody

CTGF antibody was raised in rabbit using highly pure recombinant human CTGF as the immunogen.

Rabbit polyclonal ISG15 antibody (HRP)

The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.

CCDC158 antibody was raised in Rabbit using Human CCDC158 as the immunogen

Affinity purified Rabbit polyclonal VPS37C antibody

Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific

The FYN antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the activated form of the FYN protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to effectively inhibit the activity of FYN, making it an invaluable tool for researchers studying signal transduction pathways and cellular signaling.

Affinity purified Rabbit polyclonal SCN1B antibody

Affinity purified Rabbit polyclonal Cish antibody

The Angiotensinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize angiotensinogen, a protein that plays a key role in the regulation of blood pressure and fluid balance in the body. This antibody has been extensively studied and proven to be effective in blocking the activation of angiotensinogen, thereby preventing its interaction with other molecules such as atrial natriuretic peptide and albumin.

Mouse monoclonal CD105 antibody (allophycocyanin)

Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen

EFNA4 antibody was raised in rabbit using the N terminal of EFNA4 as the immunogen

Mouse monoclonal Cytokeratin AE1 antibody

NCKIPSD antibody was raised in Rabbit using Human NCKIPSD as the immunogen

Cytokeratin 10 antibody is a highly specialized monoclonal antibody that targets the glycoprotein Cytokeratin 10. It is used for its neutralizing properties in various applications such as immunohistochemistry and Western blotting. This antibody has been extensively tested and validated to ensure its high specificity and sensitivity. It can effectively detect Cytokeratin 10 expression in adipose tissues, human serum, and other biological samples. Additionally, it has been shown to have cytotoxic effects on certain cancer cells when used in combination with active agents like Sn-38. With its exceptional binding affinity and ability to inhibit the activity of Cytokeratin 10, this antibody is a valuable tool for researchers studying autoimmune diseases, cancer biology, and interferon signaling pathways. Whether you are conducting basic research or developing diagnostic assays, this Cytokeratin 10 antibody will provide reliable and accurate results.

The STK24 antibody is a polyclonal antibody that is highly effective in targeting and neutralizing cytotoxic factors in various biological samples, including pleural fluid, human serum, and tissue culture media. This antibody specifically binds to STK24, a protein kinase involved in the regulation of cell growth and survival. By binding to STK24, this antibody inhibits its activity and prevents the downstream signaling pathways that promote cell proliferation and survival.

SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

The ATXN1 antibody is a highly reactive and neutralizing polyclonal antibody that specifically targets the ATXN1 protein. This protein is involved in various cellular processes, including cell signaling and gene expression regulation. The ATXN1 antibody has been shown to be effective in blocking the activity of ATXN1, making it an ideal tool for studying its function and potential therapeutic applications. It can also be used as a diagnostic tool to detect the presence of autoantibodies against ATXN1 in human serum. The ATXN1 antibody is produced using advanced techniques and quality control measures to ensure its purity and specificity. With its high affinity and selectivity, this monoclonal antibody provides reliable results in various research settings.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.