Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Neisseria Gonorrhoeae Antibody
Neisseria Gonorrhoeae Antibody is a growth factor that targets the annexin A2 protein. This monoclonal antibody has been developed to specifically bind to Neisseria gonorrhoeae, a bacteria responsible for causing the sexually transmitted infection gonorrhea. By targeting and binding to specific proteins on the surface of the bacteria, this antibody helps in neutralizing and eliminating the pathogen from the body. Additionally, this antibody has shown potential in inhibiting the attachment of N. gonorrhoeae to host cells, preventing its entry and subsequent infection.CDC25A antibody
CDC25A antibody was raised in rabbit using the middle region of CDC25A as the immunogen
Purity:Min. 95%Mouse anti Human IgE
Human IgE antibody was raised in mouse using purified human IgE as the immunogen.Smoothelin antibody
The Smoothelin antibody is a highly specific antibody that targets smoothelin, a protein found in smooth muscle cells. It has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is produced using state-of-the-art techniques, ensuring high affinity and specificity. It can be used to study the role of smoothelin in various physiological and pathological processes, such as smooth muscle contraction, cardiovascular diseases, and cancer. The Smoothelin antibody is an essential tool for researchers in the field of life sciences who are interested in understanding the function of smooth muscle cells and developing potential therapeutic interventions.
Goat anti Rabbit IgG (FITC)
Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%RNF212 antibody
RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
Ku70 antibody
The Ku70 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets and inhibits the activity of hepatocyte growth factor, a key growth factor involved in various cellular processes. This antibody can be used for research purposes to study the role of hepatocyte growth factor in different biological systems.
DGKE antibody
DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRPurity:Min. 95%HAX1 antibody
The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.
TLR4 antibody
The TLR4 antibody is a reactive and neutralizing monoclonal antibody that targets Toll-like receptor 4 (TLR4). It is commonly used in research and clinical settings to study the role of TLR4 in various biological processes. This antibody specifically binds to TLR4, preventing its interaction with ligands and downstream signaling molecules. By blocking TLR4 activation, the antibody inhibits the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, it has been shown to inhibit the genotoxic effects of certain substances, making it a valuable tool in genotoxicity studies. The TLR4 antibody is widely used in life sciences research, particularly in the fields of immunology and inflammation. Whether you're studying cholinergic signaling or investigating fatty acid metabolism, this antibody can provide valuable insights into cellular processes regulated by TLR4. Choose our high-quality TLR4 antibody for your
ASF1A antibody
The ASF1A antibody is a highly specific monoclonal antibody that targets the activated form of ASF1A, a phosphatase involved in various cellular processes. This antibody is colloidal in nature, allowing for easy dispersion and effective targeting of ASF1A. It has been extensively studied for its pharmacodynamics and has shown promising results as a potential medicament in the treatment of certain diseases.
TIPIN antibody
TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen
Purity:Min. 95%IL1RL1 antibody
The IL1RL1 antibody is a medicament that belongs to the class of polyclonal and monoclonal antibodies. It is cytotoxic and specifically targets the TNF-related apoptosis-inducing ligand (TRAIL) receptor 1 (IL1RL1). This antibody can be used for therapeutic purposes in various diseases where TRAIL signaling is involved, such as cancer. The IL1RL1 antibody binds to IL1RL1 on the surface of cells and induces cell death by activating apoptotic pathways. It has been shown to inhibit the growth and proliferation of cells expressing IL1RL1, making it a potential treatment option for certain types of cancer. Additionally, this antibody has been used in research studies to investigate the role of IL1RL1 in various biological processes.Purity:Min. 95%GAD67 antibody
The GAD67 antibody is a pegylated polyclonal antibody that specifically targets glutamate decarboxylase 67 (GAD67). It is commonly used in life sciences research to study the expression and function of GAD67. The antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA).
PDX1 antibody
The PDX1 antibody is a monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets alpha-fetoprotein, androgen, lysozyme, and other glycoproteins. This antibody is widely utilized in research laboratories for various applications such as protein analysis, glycan profiling, and glycosylation studies. It has also been used to detect autoantibodies in human serum samples. The PDX1 antibody offers high specificity and sensitivity, making it an essential tool for scientists working in the field of Life Sciences. Whether you are conducting experiments or performing diagnostic assays, this antibody will provide reliable results.MTIF3 antibody
MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
VSIG8 antibody
VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
Purity:Min. 95%Connexin 26 antibody
The Connexin 26 antibody is a highly effective biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the Connexin 26 protein, which plays a crucial role in cell communication. This antibody is widely used to study various cellular processes, including the regulation of glucagon secretion, autoantibody production, and the function of glycoproteins and steroids. Additionally, this monoclonal antibody has been proven to be effective in detecting and studying other biomolecules such as collagen, myelin-associated glycoprotein, interferon, and basic proteins. Researchers rely on the Connexin 26 antibody for its high specificity and reliability in their studies.
IL24 antibody
The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
