Primary Antibodies

The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.

CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.

CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.

VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.

EME1 antibody was raised in Rabbit using Human EME1 as the immunogen

Rabbit polyclonal GABRA1 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.

Rabbit polyclonal PRSS8 antibody

FEN1 antibody was raised in Rabbit using Human FEN1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.

Rabbit polyclonal Ephrin B antibody (Tyr330)

Mouse monoclonal HIV1 p55+17 antibody

The Histamine H4 Receptor antibody is a powerful tool for researchers in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs.

The SCG3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB), which is a transcription factor involved in various cellular processes. The SCG3 antibody has been shown to inhibit the polymerase activity of NF-κB, leading to a decrease in gene expression of acidic proteins. This antibody can be used in immunoassays to detect and quantify NF-κB activation. Additionally, the SCG3 antibody has proteolytic activity and has been shown to cleave caspase-9, an endonuclease involved in apoptosis. Its immobilization on surfaces allows for easy and efficient use in various experimental settings, making it a valuable tool for researchers studying NF-κB signaling pathways and related cellular processes.

Affinity purified Rabbit polyclonal ARF1 antibody

Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

Affinity purified Rabbit polyclonal HUS1 antibody

WBSCR1 antibody was raised using the middle region of Wbscr1 corresponding to a region with amino acids DSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFR

The DDX24 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically binds to nuclear binding proteins. This monoclonal antibody is highly activated and can be used for various applications in research and medicine.

The FZD4 antibody is a highly specialized antibody that targets the FZD4 protein. This protein plays a crucial role in various cellular processes, including actin dynamics and signaling pathways involved in development and disease. The FZD4 antibody is available in both polyclonal and monoclonal forms, offering researchers the flexibility to choose the best option for their specific experiments.

TFPI antibody is a monoclonal antibody that targets tissue factor pathway inhibitor (TFPI), a protein involved in the regulation of blood clotting. TFPI antibody inhibits the activity of TFPI, which leads to increased blood clotting and reduced bleeding. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, which may be beneficial in the treatment of diseases involving abnormal blood vessel growth, such as cancer and age-related macular degeneration. Additionally, TFPI antibody has been found to modulate hormone levels, including adipose and epidermal growth factors, which play important roles in various physiological processes. The use of TFPI antibody in Life Sciences research has also demonstrated its potential as a tool for studying the mechanisms of blood clotting and angiogenesis.

The p21 antibody is a chemokine that is widely used in immunoassays. It belongs to the class of polyclonal antibodies and is commonly used as a medicament in various applications. This antibody has been shown to have reactive and neutralizing properties, making it highly effective in targeting specific antigens. It is often used in research involving mesenchymal stem cells and cardiomyocytes, where it plays a crucial role in studying their functions and interactions. The p21 antibody is also used in the detection and measurement of various substances, such as steroids and recombinant antigens, through antigen-antibody reactions. In the field of Life Sciences, this antibody is an essential tool for researchers conducting experiments involving polymerase chain reactions, acetylcholine signaling, and the study of autoantibodies. With its versatility and reliability, the p21 antibody is an invaluable asset for scientists seeking to advance their understanding of cellular processes and develop innovative medical solutions.

ANGPTL4 antibody was raised in Rabbit using Human Angptl4 as the immunogen

Rabbit polyclonal AXL antibody (Tyr691)

Serotonin transporter antibody was raised in mouse using at serotonin transporter, N-terminus/GST Fusion protein (amino acids 1-85) as the immunogen.

Rabbit polyclonal RPL6 antibody

The SMAD antibody is a highly specific monoclonal antibody that targets the SMAD protein, an important regulator of cellular processes. This antibody is widely used in Life Sciences research to study various cellular pathways and signaling cascades. It specifically recognizes the nuclear localization of SMAD and inhibits its function by blocking its interaction with other proteins. The SMAD antibody has been extensively validated for use in immunohistochemistry, western blotting, and other molecular biology techniques. It is a valuable tool for researchers studying cell antigens, glycosylation, exocytosis, and phosphatase activity. Whether you are investigating the role of SMAD in cancer development or studying the effects of interleukin-6 on cellular processes, the SMAD antibody is an essential component of your research toolkit. Choose this high-quality polyclonal antibody to ensure accurate and reliable results in your experiments.

CD25 antibody (Spectral Red) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.

MLXIP antibody was raised in Rabbit using Human MLXIP as the immunogen

Affinity purified Rabbit polyclonal Galanin Receptor 2 antibody

ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

H2AFX antibody was raised using the middle region of H2AFX corresponding to a region with amino acids ELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQE

CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.

The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.

The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.

The MMP9 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and bind to the activated form of matrix metalloproteinase 9 (MMP9). This biomolecule plays a crucial role in various physiological and pathological processes, including cell-extracellular matrix interactions, tissue remodeling, and inflammation.

Affinity purified Rabbit polyclonal C20orf11 antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.