Primary Antibodies

The GHR antibody is a highly specialized monoclonal antibody that targets the hydrogen atom in natural compounds. It is designed to specifically bind to the dpp4 enzyme, inhibiting its activity and preventing the breakdown of certain hormones. This antibody is commonly used in life sciences research to study the role of dpp4 in various biological processes, including adipose tissue metabolism and hepatocyte growth. Additionally, this antibody can be utilized as a selectable marker in polymerase chain reaction (PCR) experiments or interferon assays. With its high affinity and specificity, the GHR antibody is an invaluable tool for scientists and researchers in the field of molecular biology.

EDN3 antibody was raised in rabbit using the C terminal of EDN3 as the immunogen

EIF2B2 antibody was raised in Rabbit using Human EIF2B2 as the immunogen

Rabbit polyclonal RBM41 antibody

The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.

Rabbit polyclonal NRIP2 antibody

KIF20A antibody was raised in Rabbit using Human KIF20A as the immunogen

Syrian Hamster monoclonal NK cell antibody (PE)

Armenian Hamster monoclonal CD3 antibody (PE)

SLC11A1 antibody was raised using the C terminal of SLC11A1 corresponding to a region with amino acids VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT

Affinity purified Rabbit polyclonal I309 antibody

MTMR2 antibody was raised in Rabbit using Human MTMR2 as the immunogen

Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.

Rag1 antibody was raised in rabbit using the C terminal of Rag1 as the immunogen

Affinity purified Rabbit polyclonal ARF5 antibody

Affinity purified Rabbit polyclonal HIF2 alpha antibody

Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.

C20ORF144 antibody was raised using the middle region of C20Orf144 corresponding to a region with amino acids EARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEEQPRKRCRCPRPQ

NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT

PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

The Cathepsin S antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the activity of Cathepsin S, a proteolytic enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in studies involving mesenchymal stem cells, taxol, and other related compounds. It can be used for immobilization studies, as well as in vitro assays to measure enzyme activity. The Cathepsin S antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its high specificity and affinity make it an ideal tool for studying the role of Cathepsin S in various biological processes.

The proGRP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and immobilize the proGRP protein, which plays a crucial role in various biological processes. This antibody is produced using both monoclonal and polyclonal antibodies, ensuring high specificity and sensitivity.

ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR

The WTAP antibody is a powerful tool in life sciences research. It is an antibody that specifically targets the WTAP protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.

Mouse monoclonal BCAR1 antibody

The PFKL antibody is an activated antibody that specifically targets the racemase enzyme. It is commonly used in Life Sciences research and assays to study the role of this enzyme in various biological processes. The PFKL antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options for their specific experimental needs. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and ELISA. Its high specificity and sensitivity make it a valuable tool for detecting and quantifying the presence of racemase in samples such as human serum or extracellular fluids. Additionally, the PFKL antibody can be used in combination with other cytotoxic inhibitors or antibodies to study complex signaling pathways or protein interactions. Whether you are conducting basic research or developing new diagnostic tools, the PFKL antibody is an essential component for your experiments.

Rabbit polyclonal SLC9A8 antibody

Affinity purified Rabbit polyclonal APBB3 antibody

The RAB32 antibody is a monoclonal antibody that targets the RAB32 protein. This protein plays a crucial role in various cellular processes, including the regulation of superoxide production and growth factor signaling. The RAB32 antibody has been shown to effectively neutralize the activity of RAB32, making it a valuable tool for researchers in the field of Life Sciences.

The CBG antibody is a highly specialized antibody-drug that belongs to the class of polyclonal antibodies. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets insulin-like growth factor and thrombocytopenia, making it a valuable tool for researchers studying these areas.

RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

HBeAg antibody was raised in mouse using purified HBeAg as the immunogen.

C4BPA antibody was raised in Rabbit using Human C4BPA as the immunogen

Purified Polyclonal NPAS1 antibody

LACTB2 antibody was raised in Rabbit using Human LACTB2 as the immunogen

ARD1A antibody was raised using a synthetic peptide corresponding to a region with amino acids VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE

HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG

CBLL1 antibody was raised in Rabbit using Human CBLL1 as the immunogen

The TAGLN antibody is a monoclonal antibody that acts as an anti-connexin agent. It targets connexin proteins involved in endothelial growth and adipose tissue development. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been used to study the role of connexins in angiogenesis, immune response, and cell signaling pathways. The TAGLN antibody is cytotoxic and has been shown to neutralize certain chemokines and growth factors. It is commonly used in experiments involving human serum and has also been utilized to detect alpha-fetoprotein levels. With its specificity and effectiveness, the TAGLN antibody is a valuable tool for researchers in understanding cellular processes and developing therapeutic interventions.

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.