Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
TGFBI antibody
TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Donkey anti Rat IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.Purity:Min. 95%CA 242 antibody
The CA 242 antibody is a highly specialized monoclonal antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various research areas within the Life Sciences field. This antibody specifically interacts with glial fibrillary acidic protein (GFAP), β-catenin, and oncostatin, among others.Carbonic Anhydrase I antibody
The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.
GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%TBCB antibody
TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Pirimiphos antibody
The Pirimiphos antibody is a highly effective antibody-drug that specifically targets TNF-α, a cytokine involved in inflammation and immune response. This polyclonal antibody is widely used in Life Sciences research to study the role of TNF-α and its receptor in various biological processes. It can be used for applications such as immunohistochemistry and Western blotting to detect and quantify TNF-α expression levels. The Pirimiphos antibody can also be conjugated with other molecules, such as doxorubicin, to create targeted therapies for specific diseases. With its high specificity and affinity, this monoclonal antibody offers a powerful tool for researchers studying growth factors, kinases, phosphatases, and carbonyl reductases. Its cytotoxic properties make it an ideal candidate for therapeutic applications aimed at eliminating cells expressing TNF-α.
B7H4 antibody
The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.
CD49b antibody (Allophycocyanin-CY7)
CD49b antibody (Allophycocyanin-CY7) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.
Purity:Min. 95%Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.RDBP antibody
RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS
Goat anti Human IgE (epsilon chain) (biotin)
This antibody reacts with heavy chains on human IgE (epsilon chain).Purity:Min. 95%RNF212 antibody
RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
SAMSN1 antibody
SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
Annexin A4 antibody
Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
