Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
Fetuin A antibody
Fetuin A antibody is a highly specific monoclonal antibody that targets the protein fetuin A. This protein plays a crucial role in various biological processes, including collagen synthesis, growth factor signaling, and protein kinase activation. The antibody recognizes specific acid residues on the fetuin A protein and effectively inhibits its activity.
FOXP2 antibody
The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.
Purity:Min. 95%TAZ antibody
TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.
Purity:Min. 95%Norfentanyl antibody
Norfentanyl antibody is a highly specialized monoclonal antibody that is used to inhibit the activity of norfentanyl, a potent phosphatase inhibitor. This antibody specifically targets the amide group of norfentanyl and neutralizes its effects on cellular growth factors. It has been shown to effectively block the activation of tyrosine kinase receptors and prevent the binding of autoantibodies to growth hormone receptors. Norfentanyl antibody is widely used in life sciences research and has significant applications in studying cellular signaling pathways and understanding the role of growth factors in various physiological processes.MEF2C antibody
The MEF2C antibody is a cytotoxic monoclonal antibody that targets the MEF2C protein. It has been shown to have multidrug resistance and can inhibit the production of interleukin-6 and chemokines. This antibody specifically binds to the p38 mitogen-activated protein and glycoprotein receptors, leading to cell death in cancer cells. Additionally, it has been found to have an inhibitory effect on steroid and fibronectin synthesis, which are important for tumor growth and metastasis. The MEF2C antibody is widely used in life sciences research and shows promise as a potential therapeutic agent in cancer treatment, particularly in combination with other monoclonal antibodies like trastuzumab.BAG3 antibody
BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
Purity:Min. 95%MCM3 antibody
The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.
Plasminogen antibody (HRP)
Plasminogen antibody (HRP) was raised in goat using human plasminogen purified from plasma as the immunogen.SOX4 antibody
SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen
Purity:Min. 95%HBcAg antibody
The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.
CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
HAV VP1 antibody
HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.
ATF2 antibody
The ATF2 antibody is a high-quality polyclonal antibody that specifically targets and neutralizes the activity of ATF2, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and efficacy. It binds to ATF2 with high affinity, inhibiting its function and preventing its interaction with other proteins.
S100B antibody
The S100B antibody is a highly specialized product in the field of Life Sciences. It is an antibody derived from human immunoglobulin that specifically targets the growth hormone receptor. This monoclonal antibody has been developed as a chimeric protein, which enhances its efficacy and specificity.
H+K+ ATPase antibody
H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.
ZNF275 antibody
ZNF275 antibody was raised in rabbit using the N terminal of ZNF275 as the immunogen
Purity:Min. 95%DONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
PRSS21 antibody
PRSS21 antibody was raised in rabbit using the N terminal of PRSS21 as the immunogen
Purity:Min. 95%CD22 antibody
The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.
Methylprednisolone antibody
The Methylprednisolone antibody is a monoclonal antibody that falls under the category of Life Sciences. This hormone peptide antibody specifically targets and binds to methylprednisolone, a steroid hormone. It has a glycan structure that plays a crucial role in neutralizing the effects of methylprednisolone.Purity:Min. 95%Goat anti Rat IgG (H + L)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
