Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
PSAP antibody
The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
ADAM19 antibody
ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET
Purity:Min. 95%CD24 antibody (Azide Free)
CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.
PARP2 antibody
The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.
Lamin B1 antibody
Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
GATA4 antibody
The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.
APRIL antibody
The APRIL antibody is a growth factor that plays a crucial role in endothelial growth and low-density lipoprotein (LDL) glycation. It is widely used in the field of Life Sciences for research purposes. This antibody specifically targets APRIL, which is a member of the tumor necrosis factor (TNF) superfamily. By binding to APRIL, this antibody inhibits its activity and prevents its interaction with other receptors.
AIMP2 antibody
AIMP2 antibody was raised in rabbit using the middle region of AIMP2 as the immunogen
Purity:Min. 95%Factor VIII antibody (biotin)
Factor VIII antibody (biotin) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.EXOC6 antibody
EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
RPESP antibody
RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Aggrecan antibody
The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.
SMAD2 antibody
The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.
Purity:Min. 95%CASC3 antibody
CASC3 antibody was raised using the N terminal of CASC3 corresponding to a region with amino acids MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPS
Streptococcus Group A antibody (FITC)
Streptococcus group A antibody (FITC) was raised in rabbit using group A Streptococci as the immunogen.GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE
Purity:Min. 95%GADD45A antibody
GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen
Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.
RARA antibody
The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.
FAM126A antibody
The FAM126A antibody is a highly specific monoclonal antibody that targets the FAM126A protein. This antibody has been developed for use in various applications, including immunohistochemistry, Western blotting, and ELISA. It acts as an inhibitory factor by neutralizing the activity of FAM126A.
SCYL3 antibody
SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
Atp11c antibody
Atp11c antibody was raised in rabbit using the C terminal of Atp11c as the immunogenPurity:Min. 95%HIV1 tat antibody
HIV1 tat antibody was raised in mouse using HIV-1 tat epitope mapped to N-terminus of HIV -1 tat as the immunogen.
