Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
B7H4 antibody
The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.
CACNB4 antibody
CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
GOT1 antibody
GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
CKB antibody
The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.
DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
Donkey anti Sheep IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.Purity:Min. 95%PRKACB antibody
The PRKACB antibody is a highly specific antibody that targets the protein kinase A catalytic subunit beta (PRKACB). This antibody is derived from a vaccine strain and has been extensively tested for its antigen specificity. It has shown high affinity and selectivity for PRKACB, making it an ideal tool for studying the function and regulation of this protein.
Goat anti Human IgG + IgA + IgM (H + L) (rhodamine)
Goat anti-human IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG, (H&L) as the immunogen.
CYP2A13 antibody
CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
Fos antibody
The Fos antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear protein Fos, which plays a crucial role in cellular processes such as glucose transporter regulation and growth factor signaling. This antibody is commonly used to study thrombotic microangiopathy, a condition characterized by abnormal clot formation in small blood vessels. By binding to Fos, the antibody allows researchers to visualize and analyze the activation of this important protein. In addition to its use in research, there are also polyclonal antibodies available for detecting other components of the actin filaments, such as phalloidin or actin itself. These antibodies are valuable tools for studying atypical hemolytic disorders and other conditions involving actin dynamics. With their high specificity and sensitivity, these antibodies provide researchers with reliable results for their experiments.
Complement C2 antibody
Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Purity:Min. 95%HSV2 gC antibody
HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.
C17ORF39 antibody
C17ORF39 antibody was raised using the C terminal Of C17Orf39 corresponding to a region with amino acids SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
NOTCH3 antibody
The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.
Purity:Min. 95%p73 antibody
The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.
TAZ antibody
TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.
Purity:Min. 95%BTN3A2 antibody
The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.
MYST1 antibody
MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.
BRAF antibody
The BRAF antibody is a powerful tool in the field of Life Sciences. It is an inhibitor that specifically targets BRAF, a protein involved in cell growth and division. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer.
SHMT2 antibody
The SHMT2 antibody is a highly specialized monoclonal antibody that targets the serine hydroxymethyltransferase 2 (SHMT2) protein. This protein plays a crucial role in the metabolism of fatty acids and acts as a growth factor in various cellular processes. The SHMT2 antibody specifically binds to the SHMT2 protein, allowing for its detection and analysis in research and diagnostic applications.
SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Purity:Min. 95%Influenza B antibody
Influenza B antibody was raised in goat using the yamagata strain of influenza B as the immunogen.Purity:Min. 95%Eotaxin 3 antibody (biotin)
Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.
MTIF3 antibody
MTIF3 antibody was raised using the middle region of MTIF3 corresponding to a region with amino acids AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
