Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
AF594 Donkey anti Goat IgG (H + L)
Donkey anti Goat IgG (Heavy + Light chain) secondary antibody with AF594 photostable fluorescent dye label. Minimal cross-reaction with Human, Mouse, Chicken, Rabbit, Guniea Pig, Syrian Hamster, Horse, Rat. Lyophilized from 0.01M Na3PO4, 0.25M NaCl, pH 7.6, with 15mg/ml BSA, and 0.05% NaN3. Reconstitute with 0.4 ml of distilled Water.Purity:Min. 95%IGFBP3 antibody
The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.
Purity:Min. 95%HAO1 antibody
HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
Protein S antibody
Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.Purity:Min. 95%c-Jun antibody
The c-Jun antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the c-Jun protein. This protein plays a crucial role in various cellular processes, including fibronectin production, endothelial growth, and the regulation of interleukin-6 and epidermal growth factor.
Purity:Min. 95%SLCO1B1 antibody
SLCO1B1 antibody was raised in rabbit using the middle region of SLCO1B1 as the immunogenPurity:Min. 95%ME1 antibody
ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Purity:Min. 95%CKMM antibody
CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.Human IgM antibody (Poly-HRP)
Human IgM antibody (Poly-HRP) was raised in mouse using human IgM as the immunogen.
Purity:Min. 95%TST antibody
The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.
Tau antibody
The Tau antibody is a highly specialized monoclonal antibody that targets the insulin protein. It has been extensively studied in the field of Life Sciences and has shown remarkable potential for neutralizing insulin activity. This antibody specifically binds to insulin, inhibiting its function and preventing it from interacting with its receptors.
Purity:Min. 95%Integrin Beta 5 antibody
Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALPurity:Min. 95%GPR132 antibody
The GPR132 antibody is a highly specialized chemokine that is activated in human serum. It is widely used in the field of Life Sciences and Antibodies for its ability to target specific growth factors, such as alpha-fetoprotein, and adipose tissues. This monoclonal antibody has a neutralizing effect on receptor binding, making it an effective tool for blocking specific pathways. The GPR132 antibody is commonly used in research settings, where it can be conjugated with colloidal phosphatase or other markers to facilitate detection. Its versatility and effectiveness make it an invaluable tool for studying various biological processes and identifying potential therapeutic targets.
SLC27A2 antibody
SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Purity:Min. 95%ABCB1 antibody
ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%TFE3 antibody
The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for
SRY antibody
The SRY antibody is a highly specialized growth factor that has been extensively studied in the field of Life Sciences. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and development. The SRY antibody has been shown to have a neutralizing effect on interferon-gamma (IFN-gamma), which is an important cytokine involved in immune responses.Goat anti Human Lambda Chain (Texas Red)
Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.
Purity:Min. 95%FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
GRPEL1 antibody
GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
Lactoferrin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.GHRH Receptor antibody
The GHRH Receptor antibody is a specific antibody that targets the growth hormone-releasing hormone (GHRH) receptor. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown to have neutralizing effects on the GHRH receptor, inhibiting its activity and downstream signaling pathways.
GABABR2 antibody
GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.
Purity:Min. 95%COL11A1 antibody
The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.
Gabrp antibody
Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen
Purity:Min. 95%SYCP1 antibody
SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
Purity:Min. 95%MYST1 antibody
MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.
ATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Goat anti Mouse IgM (biotin)
Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.
Purity:Min. 95%Epor antibody
Epor antibody was raised in rabbit using the N terminal of Epor as the immunogen
Purity:Min. 95%
