Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
GPR81 antibody
The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.
Calpain 2 antibody
Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.
STAT3 antibody
The STAT3 antibody is a highly effective tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets the STAT3 protein, which plays a crucial role in various cellular processes such as growth factor signaling and actin filament formation. By binding to STAT3, this antibody allows researchers to study its activation and function.
RBM39 antibody
RBM39 antibody was raised using the N terminal of RBM39 corresponding to a region with amino acids ADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSK
RHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
MPP5 antibody
MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
C-peptide antibody
The C-peptide antibody is a monoclonal antibody that is used for various applications in medical research and diagnostics. It is designed to specifically target and bind to the C-peptide, a peptide released during the processing of proinsulin into insulin. This antibody has been extensively characterized and validated for its high specificity and sensitivity.
STAT1 antibody
The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.
Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.
Purity:>92% By Gel Electrophoresis And Gel ScanningCHRND antibody
CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen
Purity:Min. 95%HRB antibody
HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN
FBXO18 antibody
FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
Desmoplakin 1+2 antibody
Desmoplakin 1+2 antibody was raised in mouse using C-terminal polypeptide of recombinant human desmoplakin as the immunogen.
SLCO1B1 antibody
SLCO1B1 antibody was raised in rabbit using the middle region of SLCO1B1 as the immunogenPurity:Min. 95%Rabbit anti Goat IgG (H + L) (FITC)
Rabbit anti-goat IgG (H+L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
HES2 antibody
The HES2 antibody is a polyclonal antibody that specifically targets the serum albumin protein. It has cytotoxic properties and is widely used in Life Sciences research. The HES2 antibody has been shown to interact with various proteins, including angptl3, e-cadherin, taxol, β-catenin, and osteopontin. It is commonly used in experiments involving hybridization and activated human serum. This antibody is highly effective in detecting and analyzing specific proteins in biological samples, making it an essential tool for researchers in various fields.
Vav antibody
The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.
Purity:Min. 95%
