Primary Antibodies

<p>COPE antibody was raised in Rabbit using Human COPE as the immunogen</p>

<p>The CASP8 antibody is a highly specialized polyclonal antibody that has been biotinylated for enhanced detection capabilities. It specifically targets the elastase protein and bovine γ-globulin, making it an essential tool in various research applications within the Life Sciences field. The CASP8 antibody is also available in monoclonal form, providing consistent and reliable results.</p>

<p>Purified Rabbit polyclonal OR52E5 antibody</p>

<p>MRPL45 antibody was raised in rabbit using the C terminal of MRPL45 as the immunogen</p>

<p>The FKBPL antibody is a high-quality polyclonal antibody that is colloidal in nature. It specifically targets the thioredoxin interacting protein (FKBPL) and forms a strong disulfide bond with it. This antibody is widely used in life sciences research for various applications, including the study of reactive growth factors and biomolecules. It can also be used as a drug antibody or diagnostic reagent due to its high specificity and affinity for FKBPL. Additionally, this antibody has shown promising results in collagen-related research and can be used in electrode-based assays. For researchers looking for a reliable monoclonal antibody, the FKBPL antibody is an excellent choice. Its effectiveness against TGF-beta makes it an essential tool for studying this important signaling pathway.</p>

<p>DCUN1D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL</p>

<p>The GFRA4 antibody is an affinity ligand that specifically targets interleukin receptors. It has been isolated from retinal tissue and can be used as a test compound in various research studies. This antibody shows potential for the development of new medicines, particularly in the field of nuclear medicine and anti-thrombotic therapies. The GFRA4 antibody is part of a group of antibodies known as polyclonal antibodies, which are widely used as inhibitors or intermediates in various biomedical applications. Additionally, it has shown promise in the detection and treatment of autoantibodies and can be utilized in adeno-associated virus-based therapies. With its versatility and specificity, the GFRA4 antibody holds great potential for advancing scientific research and medical advancements.</p>

<p>CD18 antibody (Azide free) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.</p>

<p>LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL</p>

<p>Rabbit polyclonal GluR1 antibody (Ser849)</p>

<p>The Aggrecan antibody is a highly effective inhibitor that belongs to the class of Monoclonal Antibodies. It targets and neutralizes Vascular Endothelial Growth Factor (VEGF), a growth factor involved in angiogenesis. By blocking VEGF, the Aggrecan antibody prevents the formation of new blood vessels, inhibiting tumor growth and metastasis. Additionally, this antibody has been shown to inhibit the production of superoxide, a reactive oxygen species that can cause oxidative damage to cells. The Aggrecan antibody also binds to insulin and insulin-like growth factor binding proteins, regulating their activity and promoting cellular responses such as cell proliferation and survival. With its wide range of applications in Life Sciences research, this antibody is an essential tool for studying various biological processes and developing therapeutic strategies.</p>

<p>Purified Rabbit polyclonal WRKY67.1 antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>IER5L antibody was raised using the middle region of IER5L corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA</p>

<p>The CENPE Antibody is a highly effective inhibitor and reagent that serves as a valuable biomarker in the field of Life Sciences. This monoclonal antibody is specifically designed to target and inhibit CENPE, a key protein involved in the regulation of hematopoietic and pluripotent stem cells. With its high specificity and affinity, this antibody can be used for various applications including immunohistochemical staining and detection of CENPE expression in different cell types.</p>

<p>The Aml1 antibody is a powerful tool in the field of immunology. It is an antibody that specifically targets and neutralizes the activity of ACTH, a hormone involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the growth and proliferation of Mycoplasma genitalium, a common pathogen responsible for several sexually transmitted infections. Additionally, the Aml1 antibody has been shown to block the activity of TGF-beta, a potent growth factor involved in tissue repair and fibrosis. Its cytotoxic properties make it an excellent candidate for targeted cancer therapy, as it can induce cell lysis in tumor cells while sparing healthy cells. Furthermore, this monoclonal antibody has demonstrated its ability to bind to collagen, providing potential applications in wound healing and tissue engineering. Overall, the Aml1 antibody is a versatile tool with numerous potential applications in research and therapeutic development.</p>

<p>Purified Rabbit polyclonal BCL2 antibody (Ser70)</p>

<p>Mouse monoclonal PSMD2 antibody</p>

<p>RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV</p>

<p>CD3e antibody (Azide free) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.</p>

<p>Rabbit polyclonal LAMA2 antibody</p>

<p>DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANS</p>

<p>RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids  DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM</p>

<p>C1ORF96 antibody was raised using the N terminal Of C1Orf96 corresponding to a region with amino acids LGRRLLEQAHAPWLWDDWGPAGSSEDSASSESSGAGGPAPRCAPPSPPPP</p>

<p>Rabbit polyclonal DGKZ antibody</p>

<p>The FOS antibody is a glycoprotein that belongs to the family of epidermal growth factor (EGF)-like antibodies. It contains sugar moieties that enhance its stability and functionality. This antibody has been shown to have endonuclease activity, which allows it to cleave DNA at specific sites. Additionally, it exhibits glutamate and hyaluronidase activity, making it useful in various biochemical assays. The FOS antibody can also be pegylated to increase its half-life and improve its pharmacokinetic properties. In life sciences research, this antibody is commonly used for immunostaining and Western blotting experiments. Its high specificity and affinity make it an excellent tool for studying protein expression patterns and understanding cellular signaling pathways. Furthermore, the FOS antibody has been shown to inhibit microvessel density and collagen synthesis, suggesting potential therapeutic applications in angiogenesis-related disorders. Its ability to modulate TGF-beta signaling further expands its potential use in cancer research and tissue engineering studies.</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>