Primary Antibodies

Rabbit polyclonal MRCKB antibody

TGFR3 antibody is a polyclonal antibody that specifically targets the TGFR3 protein. It is commonly used in life sciences research to study the role of TGFR3 in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.

Amylase antibody is a polyclonal antibody that specifically targets and binds to amylase, an enzyme responsible for the breakdown of starch into sugars. This antibody has been widely used in life sciences research to study the role of amylase in various biological processes.

TH antibody was raised in rabbit using the n terminal of TH as the immunogen

Affinity purified Rabbit polyclonal TFEC antibody

The CLPP antibody is a monoclonal antibody that specifically targets the CLPP protein. This glycoprotein plays a crucial role in various biological processes and has been extensively studied in the field of Life Sciences. The CLPP antibody recognizes and binds to the histidine residues on the CLPP protein, allowing for accurate detection and analysis.

DUOXA1 antibody was raised in rabbit using the C terminal of DUOXA1 as the immunogen

Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody

Affinity purified Rabbit polyclonal SART1 antibody

The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.

ALDH1B1 antibody was raised in Rabbit using Human ALDH1B1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.

Rabbit polyclonal GRIN1 antibody (Splice Variant C1)

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

Rabbit polyclonal PITPNM1 antibody

The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.

Rabbit polyclonal SERC3 antibody

ATP6V1G3 antibody was raised in Rabbit using Human ATP6V1G3 as the immunogen

The Livin antibody is a powerful tool in Life Sciences research. It specifically targets mesothelin, a protein that is often overexpressed in various types of cancer. By binding to mesothelin, the Livin antibody can be used to detect and measure its presence in human serum samples. Studies have shown that high levels of mesothelin are associated with increased microvessel density and tumor growth, making it an important marker for cancer prognosis and treatment.

The Src antibody is a specific antibody used in Life Sciences research. It targets protein tyrosine kinases, specifically the Src family of kinases. This antibody has been shown to induce apoptosis in various cell types by activating the TNF-related apoptosis-inducing ligand (TRAIL) pathway. It can also inhibit the activity of interferon and epidermal growth factor signaling pathways. The Src antibody is available in stable liquid formulations for easy handling and storage. Whether you need a monoclonal or polyclonal antibody, the Src antibody is a reliable choice for your research needs. Additionally, studies have suggested that this antibody may have potential therapeutic applications in conditions such as hepatic steatosis.

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

Affinity purified Rabbit polyclonal FAM122B antibody

Affinity purified Rabbit polyclonal ATP synthase delta antibody

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

Affinity purified Rabbit polyclonal MID1IP1 antibody

Sheep polyclonal DNM1 antibody (Ser774)

EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE

The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.

GADD45GIP1 antibody was raised in Rabbit using Human GADD45GIP1 as the immunogen

The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.

TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen

The Troponin T antibody is an immunosuppressant that belongs to the group of polyclonal antibodies. It specifically targets calmodulin, a protein involved in muscle contraction and relaxation. This antibody is buffered and has neutralizing properties, making it highly effective in inhibiting the activity of calmodulin. In addition to its immunosuppressive effects, the Troponin T antibody has been shown to promote the growth of factors that regulate cell proliferation and differentiation. It also exhibits diuretic properties by enhancing the excretion of fluids from the body. This antibody is widely used in life sciences research, particularly in studies involving interleukin-6 and other cytokines. The Troponin T antibody is available as a monoclonal antibody, which ensures high specificity and affinity for its target antigen. Its versatility extends beyond research applications, as it can also be used for diagnostic purposes, such as detecting influenza hemagglutinin or monitoring signaling pathways involving PI3-kinase

The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.

Affinity purified Goat polyclonal Presenilin 2 antibody

The RPA70 antibody is a highly specific reagent used in scientific research for various applications. It is commonly used in polymerase chain reactions (PCR) and immunohistochemical detection to study protein-protein interactions and cellular processes. This polyclonal antibody recognizes the RPA70 protein, which plays a crucial role in DNA replication and repair.

Affinity purified Rabbit polyclonal GIMAP8 antibody

The RALB antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the RALB protein, which plays a crucial role in various cellular processes such as epidermal growth factor signaling, low-molecular-weight chemokine production, and endothelial cell growth. This antibody has been extensively used in research to study the function and regulation of RALB.

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.