Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
MCM3 antibody
The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.
HBcAg antibody
The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.
Donkey anti-Mouse IgG (H+L) biotin
Donkey ant-mouse IgG (H + L) secondary antibody biotinPurity:Min. 95%Rat Thrombocyte antibody
Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.
Purity:Min. 95%CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
Donkey anti Mouse IgG (H + L) (FITC)
Donkey anti-mouse IgG (H + L) (FITC) was raised in donkey using mouse IgG (H&L) as the immunogen.
Purity:Min. 95%FKHR antibody
The FKHR antibody is a powerful growth factor and hormone peptide that plays a crucial role in various biological processes. It is commonly used in research and diagnostics to detect the presence of FKHR in samples.
Purity:Min. 95%ZNF335 antibody
ZNF335 antibody was raised in rabbit using the middle region of ZNF335 as the immunogen
Purity:Min. 95%Caspase 8 antibody
Caspase 8 antibody is a highly specific monoclonal antibody that targets caspase 8, an enzyme involved in programmed cell death. This antibody has been extensively tested and validated for its ability to detect and inhibit caspase 8 activity. It can be used in various life science research applications including immunohistochemistry, western blotting, and flow cytometry. The Caspase 8 antibody has been shown to effectively block the activity of caspase 8, making it a valuable tool for studying apoptosis and cell death pathways. Its high specificity ensures accurate and reliable results, making it an essential component in many research projects.
CD38 antibody (Spectral Red)
CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molSIX1 antibody
The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.
Goat anti Human Kappa Chain (Fab'2) (FITC)
Goat anti-human kappa chain (Fab'2) (FITC) was raised in goat using human kappa light chain as the immunogen.Purity:Min. 95%ZDHHC19 antibody
ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
Purity:Min. 95%NPM antibody
Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.FOXP2 antibody
The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.
Purity:Min. 95%FBXO24 antibody
FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG
WNT16 antibody
WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN
LIPT1 antibody
LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
SAA4 antibody
SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK
Purity:Min. 95%RAP1GDS1 antibody
The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
