Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Interferon gamma antibody
The Interferon gamma antibody is a monoclonal antibody that targets interferon gamma, a growth factor involved in immune response regulation. This antibody is widely used in Life Sciences research to study the functions and effects of interferon gamma. It can be used for various applications such as immunohistochemistry, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). The Interferon gamma antibody specifically binds to interferon gamma and can be used to detect its presence in biological samples. It has high specificity and sensitivity, making it an essential tool for researchers studying the role of interferon gamma in various biological processes.
HIPK2 antibody
The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.
DKK3 antibody
The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
CSB antibody
CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.
MELK antibody
The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.
CEA antibody
The CEA antibody is a monoclonal antibody used in Life Sciences. It has pro-angiogenic activity, meaning it promotes the growth of new blood vessels. This antibody can be used in various research applications, such as immunoassays and immunohistochemistry, to detect and quantify CEA (carcinoembryonic antigen) levels. CEA is a protein that is often elevated in certain types of cancer, particularly colorectal cancer. By targeting CEA, this antibody can help researchers better understand the role of CEA in cancer development and progression. Additionally, the CEA antibody has been shown to interact with other proteins, such as annexin A2 and epidermal growth factor, suggesting potential involvement in signaling pathways related to cell growth and proliferation. With its high specificity and sensitivity, the CEA antibody is a valuable tool for studying CEA-related processes and developing diagnostic tests for cancer detection.Eotaxin 3 antibody (biotin)
Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.
ZNF567 antibody
ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogenPurity:Min. 95%Calpain 2 antibody
Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.
ATG5 antibody
ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTDPurity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
