Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Rabbit anti Goat IgG (H + L) (FITC)
Rabbit anti-goat IgG (H+L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%BIRC5 antibody
The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.
CD23 antibody
CD23 antibody is a monoclonal antibody that specifically targets the CD23 protein, a molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study the function and regulation of CD23. It can be used to detect and quantify CD23 expression levels in cells or tissues, providing valuable insights into its role in different physiological and pathological conditions. Additionally, CD23 antibody has been shown to inhibit the activity of derivatives such as ferritin and fibrinogen, suggesting its potential therapeutic applications in oxidative damage and inflammatory disorders. Furthermore, this antibody has been found to modulate hepatocyte growth factor and collagen synthesis, indicating its involvement in tissue repair and regeneration processes. With its high specificity and versatility, CD23 antibody is an indispensable tool for researchers studying various aspects of cellular signaling pathways and molecular interactions involving CD23.
CATSPER2 antibody
CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
FSH antibody
The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.
Purity:Min. 95%APRIL antibody
The APRIL antibody is a growth factor that plays a crucial role in endothelial growth and low-density lipoprotein (LDL) glycation. It is widely used in the field of Life Sciences for research purposes. This antibody specifically targets APRIL, which is a member of the tumor necrosis factor (TNF) superfamily. By binding to APRIL, this antibody inhibits its activity and prevents its interaction with other receptors.
ALOX15 antibody
ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLPurity:Min. 95%Goat anti Human IgG + IgA + IgM (Alk Phos)
This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.
Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly specialized monoclonal antibody that targets the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell growth and division, making it an important target for cancer treatment. The EGFR antibody works by binding to the EGFR on the surface of cancer cells, blocking its activation and preventing further cell proliferation.
A2M antibody
The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.
Purity:Min. 95%HAV VP1 antibody
HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.
CROT antibody
The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.
IDH1 antibody
IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
Mouse anti Human Kappa Light Chain antibody
Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.
Mouse Thrombocyte antibody
Mouse thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.Purity:Min. 95%CCR6 antibody
The CCR6 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets and binds to the CCR6 protein, which plays a crucial role in various biological processes. The CCR6 antibody can be used for research purposes such as studying the activation of growth factors and tyrosine kinase receptors. It has also been shown to have cytotoxic effects, making it a potential candidate for antibody-drug conjugates.
GPC3 antibody
GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
YAP1 antibody
The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.
EpCAM antibody
The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in Life Sciences research for various applications. This neutralizing antibody can effectively block the interaction between EpCAM and its ligands, preventing downstream signaling events.
IL8 antibody
The IL8 antibody is a monoclonal antibody that specifically targets and binds to IL8, a growth factor involved in various biological processes. This antibody is widely used in life sciences research, particularly in bioassays and immunoassays to detect and quantify IL8 levels. It can also be used for therapeutic purposes, especially in the treatment of intraocular diseases associated with elevated IL8 levels.PCDHAC2 antibody
PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
