Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Annexin I antibody
The Annexin I antibody is a valuable tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been extensively tested and proven to be highly effective in a variety of applications.
PELI1 antibody
The PELI1 antibody is an anti-HER2 antibody that plays a crucial role in endocytic uptake. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets HER2, a protein that is overexpressed in certain cancer cells, including breast cancer. By binding to HER2, the PELI1 antibody inhibits its signaling pathway and prevents the growth and proliferation of cancer cells.
ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
Fam55d antibody
Fam55d antibody was raised in rabbit using the C terminal of Fam55d as the immunogen
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
