Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75459 products of "Primary Antibodies"
SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Purity:Min. 95%p16 antibody
P16 antibody was raised in Mouse using a purified recombinant fragment of P16 expressed in E. coli as the immunogen.Factor VIII antibody
Factor VIII antibody was raised in mouse using human factor VIII as the immunogen.
LYRM1 antibody
LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
