Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
Donkey anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Purity:Min. 95%MPO antibody
The MPO antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to myeloperoxidase (MPO), an enzyme involved in various physiological processes. This antibody has been extensively studied for its role in inflammation, immune response, and cardiovascular diseases.
FRZB antibody
FRZB antibody was raised in rabbit using the middle region of FRZB as the immunogen
Purity:Min. 95%HIV1 gp41 antibody
HIV1 gp41 antibody was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.Purity:Min. 95%Atrazine antibody
The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and detect tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter essential for brain function. This antibody is commonly used in immunoassays to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.
Purity:Min. 95%FABP antibody
The FABP antibody is a growth factor that targets adipose tissue. It is a monoclonal antibody specifically designed to bind to fatty acid binding proteins (FABPs). FABPs play a crucial role in the transport and metabolism of fatty acids within cells. By targeting FABPs, this antibody can modulate their activity and potentially impact various cellular processes.VEGFC antibody
The VEGFC antibody is a monoclonal antibody that targets and neutralizes the activity of Vascular Endothelial Growth Factor C (VEGFC). This antibody plays a crucial role in inhibiting the activation of TNF-α, leukemia inhibitory factor, and other oncogenic kinases. By binding to VEGFC, this antibody prevents its interaction with its receptors, thereby inhibiting the signaling pathways involved in angiogenesis and lymphangiogenesis.
UBE2L3 antibody
UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK
PPAR alpha antibody
PPAR Alpha antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) V D T E S P I C P L S P L E A D D(18) C of mouse PPAR alpha.Purity:Min. 95%AKR1B10 antibody
The AKR1B10 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets AKR1B10, an enzyme involved in various cellular processes. This antibody offers high photostability and has been extensively tested for its specificity and sensitivity.
Cul4B antibody
The Cul4B antibody is a highly specialized and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the Cul4B protein, which plays a crucial role in various cellular processes. The Cul4B protein is involved in the regulation of epidermal growth factor signaling, parathyroid hormone-related protein expression, and chemokine-like activity.
ADA antibody
ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEPurity:Min. 95%Triosephosphate isomerase antibody
Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.
NAT9 antibody
NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ
ACADM antibody
ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
PIWIL1 antibody
PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
