Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
Fibronectin antibody
The Fibronectin antibody is a polyclonal antibody that specifically targets fibronectin, a glycoprotein involved in cell adhesion and migration. This antibody is widely used in life sciences research to study the role of fibronectin in various biological processes. It can be used to detect and quantify fibronectin levels in different samples, such as tissues or cell cultures. The Fibronectin antibody has also been shown to have potential therapeutic applications, particularly in cancer treatment. Studies have demonstrated its ability to inhibit tumor growth by blocking the interaction between fibronectin and its receptor on cancer cells. Additionally, this antibody has been used in combination with other drugs, such as sorafenib, to enhance their anti-cancer effects. Whether you are conducting research or developing new therapies, the Fibronectin antibody is an essential tool for studying fibronectin biology and its potential applications in various fields of medicine.
Annexin A5 antibody
The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.
HBsAg antibody
HBsAg antibody is a glycoprotein that plays a crucial role in the immune response against hepatitis B virus (HBV) infection. It has catalase activity and promotes endothelial growth, making it an essential factor in various physiological processes. Additionally, HBsAg antibody has been found to be associated with antiphospholipid antibodies, which are autoantibodies that target phospholipids and can lead to blood clotting disorders. Monoclonal antibodies targeting HBsAg have shown promising results in the treatment of HBV infection. These antibodies specifically bind to the surface antigen of the virus, preventing its attachment to host cells and neutralizing its infectivity. One example of such a monoclonal antibody is trastuzumab, which is also used in the treatment of HER2-positive breast cancer. Furthermore, HBsAg antibody has been implicated in regulating cell growth and proliferation through its interaction with growth factors such as epidermal growth factor (EGF). StudiesCDC2 antibody
The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.
PKC alpha antibody
The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.
UBE2L3 antibody
The UBE2L3 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the UBE2L3 protein, which plays a crucial role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
Goat anti Cat IgG (Texas Red)
Goat anti-cat IgG was raised in goat using feline IgG F(ab')2 fragment as the immunogen.
Purity:Min. 95%ERG antibody
The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.
CD4 antibody (FITC)
CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.
CD11c antibody (FITC)
CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.
Purity:Min. 95%RGS13 antibody
RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
WDR4 antibody
WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
CD45.2 antibody (biotin)
CD45.2 antibody (biotin) was raised in mouse using CD45.2 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molSOCS1 antibody
SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA
FABP antibody
FABP antibody is a growth factor that has been modified with colloidal acid to enhance its neutralizing properties. It specifically targets lipoprotein lipase and inhibits its activity, making it an effective tool in studying the role of lipoproteins in various biological processes. This antibody has undergone glycosylation, which improves its stability and bioavailability. FABP antibody is commonly used in Life Sciences research, particularly in studies involving interferon and monoclonal antibodies. It can be immobilized on cellulose for purification purposes or used as a detection tool in assays. Whether you need a monoclonal or polyclonal antibody, FABP antibody is a valuable tool for your research needs.
IL6 antibody
IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various immune responses. IL-6 plays a crucial role in inflammation, autoimmune disorders, and cancer progression. The IL6 antibody binds to IL-6, neutralizing its activity and preventing it from binding to its receptors.
IFI44L antibody
IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
C1R antibody
The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.
KCNQ2 antibody
KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
ZO1 antibody
The ZO1 antibody is a highly effective monoclonal antibody that specifically targets CD33, a cell surface protein. This antibody is widely used in the field of life sciences for various applications. It has been shown to inhibit the growth of cancer cells, such as MCF-7 breast cancer cells, by blocking the action of growth factors and interfering with cell signaling pathways. Additionally, the ZO1 antibody has been used in research involving mesenchymal stem cells to study their differentiation potential and therapeutic applications. Furthermore, this antibody can be utilized in immunohistochemistry and western blotting assays to detect and quantify specific proteins of interest. With its exceptional specificity and sensitivity, the ZO1 antibody is an invaluable tool for scientists and researchers in their quest for new discoveries in the field of molecular biology.
CITED4 antibody
CITED4 antibody was raised in rabbit using the N terminal of CITED4 as the immunogenPurity:Min. 95%Prolactin Receptor antibody
The Prolactin Receptor antibody is a growth factor that belongs to the class of monoclonal antibodies. It has neutralizing properties and can effectively inhibit the activity of prolactin, a hormone involved in lactation and reproductive functions. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
