Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Helicobacter pylori antibody
Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.PSME3 antibody
PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
MURF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes.
Annexin A3 antibody
Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
CDCA5 antibody
CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST
POU2F1 antibody
The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.
ATF3 antibody
The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.
Syntrophin Beta 1 antibody
Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELPurity:Min. 95%IpaD antibody
The IpaD antibody is a glycoprotein that has denaturing properties. It is known for its neuroprotective and neutralizing effects. This high polymer glycan has been found to interact with hormone peptides and collagens. The IpaD antibody is produced through the use of monoclonal antibodies, which are created through recombinant techniques. Its glycosylation plays a crucial role in its functionality. It should be noted that this antibody may have teratogenic effects and caution should be exercised when using it. The IpaD antibody is commonly used in research and diagnostic applications due to its specificity and affinity for its target antigen.CAP1 antibody
The CAP1 antibody is a highly specialized monoclonal antibody that targets the fibronectin protein. It specifically recognizes and binds to specific amino acid residues on fibronectin, inhibiting its function. This antibody has been extensively studied in the field of Life Sciences and has shown remarkable pharmacokinetic properties.
CTBP1 antibody
The CTBP1 antibody is a polyclonal antibody that is used in Life Sciences research. It has a high affinity for the low-density lipoprotein receptor-related protein 1 (LRP1) and can be used to study its role in various cellular processes. The CTBP1 antibody has been shown to inhibit the binding of epidermal growth factor (EGF) to LRP1, suggesting that it may play a role in EGF signaling pathways. Additionally, this antibody has been used to detect autoantibodies against CTBP1 in patients with certain autoimmune diseases. The CTBP1 antibody can be used in various techniques such as immunohistochemistry, western blotting, and ELISA to detect and quantify CTBP1 expression levels. Its specificity and sensitivity make it an ideal tool for researchers studying the function of CTBP1 and its potential as a therapeutic target.
PPP1R3B antibody
PPP1R3B antibody was raised in rabbit using the N terminal of PPP1R3B as the immunogen
CBS antibody
The CBS antibody is an endogenous hematopoietic monoclonal antibody that plays a crucial role in various Life Sciences applications. It is commonly used as a nuclear marker and can be utilized in experiments involving electrodes. The CBS antibody is highly specific and exhibits strong binding affinity to its target, making it an ideal tool for research purposes. Additionally, this antibody has been shown to have inhibitory effects on fatty acid metabolism and can serve as a valuable tool for studying the role of fatty acids in cellular processes. Antibodies against CBS are also used in diagnostic assays to detect autoantibodies in human serum samples. Furthermore, the CBS antibody has demonstrated anti-angiogenesis properties, making it a potential therapeutic candidate for conditions characterized by abnormal blood vessel growth. In summary, the CBS antibody is a versatile and valuable tool in the field of Life Sciences with diverse applications ranging from research to diagnostics and therapeutics.
ELAVL4 antibody
ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
Haptoglobin antibody
Haptoglobin antibody was raised in goat using human haptoglobin as the immunogen.
Purity:Min. 95%SGLT1 antibody
SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.Purity:Min. 95%DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
MMP10 antibody
The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.
NSUN2 antibody
NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP
AHCY antibody
AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA
CHKA antibody
CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
