Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
RAP1 antibody
The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.
VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.
CD11b antibody (PE)
CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.
Purity:Min. 95%Mouse IgG Purified
The purified Mouse IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.
Purity:>95% By Sds-PageRNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Purity:Min. 95%PTGES antibody
PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
