Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
STK11 antibody
STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
SLC12A2 antibody
SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
PACRG antibody
PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ
STAT1 antibody
The STAT1 antibody is a glycopeptide that specifically targets and binds to the STAT1 protein. It is used in various research applications, including the detection and quantification of autoantibodies. The STAT1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.
PGAM1 antibody
The PGAM1 antibody is a highly versatile and potent tool used in various industries, including Life Sciences and industrial applications. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on the growth factor. It can be immobilized for use in various assays, making it an essential component in molecular biology research.
Goat anti-Human IgG antibody
The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.
Pseudorabies Virus antibody
Pseudorabies Virus antibody is a vital tool in the field of Life Sciences. It is a polyclonal antibody that can be used for various applications. This antibody specifically targets the Pseudorabies Virus, which is a highly contagious viral disease that affects animals, especially pigs. The Pseudorabies Virus antibody can be used in research studies to detect and quantify the presence of the virus in samples.
CD137L antibody
CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.
Lamin antibody
Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKE-A6 cells) as the immunogen.
PCMT1 antibody
PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD
TSHR antibody
TSHR antibody was raised using the C terminal of TSHR corresponding to a region with amino acids KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS
PAWR antibody
The PAWR antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It has been found to be effective in neutralizing autoantibodies, stimulating colony growth, and regulating the epidermal growth factor. Additionally, this antibody has shown promising results in inhibiting caspase-9 activity, which is essential for apoptosis.
GALNT2 antibody
The GALNT2 antibody is a monoclonal antibody that targets the GALNT2 protein. This antibody is commonly used in life sciences research, particularly in the study of growth factors and tyrosine kinase receptors. It can be used in immunoassays to detect and quantify GALNT2 levels in various biological samples.
SREBF2 antibody
SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen
BRM antibody
The BRM antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It is an inhibitor that targets specific virus surface antigens, preventing their interaction with host cells and inhibiting viral replication. This antibody has shown high efficacy against a wide range of viruses, including those causing respiratory infections, influenza, and herpes.
RTN4 antibody
RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Purity:Min. 95%Myosin Ic antibody
Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
EED antibody
The EED antibody is a highly specialized and potent anti-mesothelin antibody that is widely used in Life Sciences research. It has the ability to bind specifically to mesothelin, a protein that is involved in cell growth and signaling pathways. This antibody is commonly used in studies related to growth factors, chemokines, and other important biological processes. Additionally, the EED antibody has been shown to have neutralizing properties against mesothelin, making it an ideal tool for studying the effects of this protein in various experimental settings. It can be used in a variety of applications including immunohistochemistry, Western blotting, ELISA, and more. With its high specificity and affinity for mesothelin, the EED antibody provides researchers with a valuable tool for understanding the role of this protein in disease development and progression.
G6PD antibody
G6PD antibody was raised in mouse using recombinant human G6PD (35-506aa) purified from E. coli as the immunogen.Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
