Primary Antibodies

The GRM1 antibody is a monoclonal antibody that has been developed for the treatment of thrombotic microangiopathy and atypical hemolytic disorders. It specifically targets the glucose transporter nuclear protein, which plays a crucial role in the development and progression of these conditions. The GRM1 antibody has shown promising results in preclinical studies, effectively reducing thrombotic events and improving overall patient outcomes. This drug antibody can be administered as an intravenous infusion, with the effective dose determined based on individual patient characteristics. In addition to its therapeutic potential, the GRM1 antibody is also widely used in life sciences research for various applications, including immunohistochemistry and flow cytometry analysis. Whether you are a researcher or a healthcare professional, the GRM1 antibody offers a valuable tool for studying and treating thrombotic microangiopathy and atypical hemolytic disorders.

The RuBisCO antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and interacts with RuBisCO, an enzyme involved in the carbon fixation process during photosynthesis. This antibody has been extensively studied and proven to be effective in various research applications.

NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

The CDK2 antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been found to be effective in inhibiting the growth of hepatocyte, promoting natriuretic activity, and regulating fibrinogen activation. The CDK2 antibody is also known for its histidine glycosylation properties, which enhance its stability and binding affinity. Additionally, this antibody has been used in the detection and quantification of autoantibodies and steroids. With its high specificity and reliability, the CDK2 antibody is a valuable tool for researchers in need of accurate and precise measurements in their studies.

HOXB1 antibody was raised in Rabbit using Human HOXB1 as the immunogen

CTSF antibody was raised in Rabbit using Human CTSF as the immunogen

DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Affinity purified Rabbit polyclonal EIF5A2 antibody

Mouse monoclonal PLEKHA3 antibody

The SET antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to the SET protein, which plays a crucial role in various cellular processes. The SET antibody has been extensively tested and validated for its high specificity and sensitivity in detecting the presence of SET protein.

Affinity purified Rabbit polyclonal OPCml antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its potent bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it exhibits high efficacy against Mycobacterium tuberculosis strains. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infection.

ABL2 antibody was raised in Mouse using a purified recombinant fragment of ABL2 expressed in E. coli as the immunogen.

The Syntaxin 4 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain oncogenic kinases. This antibody targets the binding proteins involved in the activation of these kinases, effectively blocking their activity and preventing the growth and proliferation of cancer cells.

FABP5 antibody was raised in Rabbit using Human FABP5 as the immunogen

The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

Affinity purified Rabbit polyclonal SLC6A4 antibody

Goat anti-human IgG (H + L) (HRP) was raised in goat using hamster IgG (H & L) as the immunogen.

Rabbit polyclonal QRSL1 antibody

IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.

Rabbit polyclonal POF1B antibody

Transferrin antibody was raised in rabbit using human transferrin as the immunogen.

Mouse monoclonal KCNAB1 antibody

Rabbit polyclonal COX5A antibody (FITC)

Rat monoclonal CD25 antibody (biotin)

The CCR5 antibody is a monoclonal antibody that has been widely used in Life Sciences research. It targets the CCR5 receptor, a glycoprotein found on the surface of immune cells. This antibody has been shown to have neutralizing effects on CCR5, blocking its interaction with the ligands and inhibiting viral entry into host cells. It has been used in various immunoassays and hybridoma cell studies to investigate the role of CCR5 in immune response and disease progression. Additionally, this antibody has been utilized for its potential antiviral properties, particularly against HIV-1 strains that use CCR5 as a co-receptor for viral entry. Its specificity and high affinity make it a valuable tool for studying CCR5-related signaling pathways and developing therapeutic strategies targeting this receptor.

Mouse monoclonal ARHGAP25 antibody

Mouse monoclonal UNG antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections by inhibiting bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for treating respiratory disorders caused by bacteria such as Clostridium perfringens. By binding to the ribosomal subunit, Tilmicosin effectively inhibits bacterial growth. Studies have shown that Tilmicos

The CFOS antibody is a highly specialized antibody that has antiangiogenic properties. It is commonly used in Life Sciences research to study the formation of new blood vessels and their role in various biological processes. The CFOS antibody works by inhibiting the pro-angiogenic activity of certain proteins, such as epidermal growth factor, that are involved in promoting blood vessel growth. This monoclonal antibody binds specifically to CFOS, a basic protein that plays a key role in regulating cell growth and differentiation. By targeting CFOS, the CFOS antibody can effectively block the formation of new blood vessels and inhibit tumor growth. It is available as both a polyclonal and monoclonal antibody, providing researchers with options for their specific experimental needs. With its high specificity and cytotoxic effects on endothelial cells, the CFOS antibody has proven to be a valuable tool in studying angiogenesis and developing potential anti-cancer therapies.

Rabbit polyclonal TERF2 antibody

The SP1 antibody is a glycoprotein inhibitor that is pegylated and classified as a monoclonal antibody. It is commonly used in Life Sciences research and has various applications. The SP1 antibody has been found to be effective in neutralizing the activity of trastuzumab, an antibody used in the treatment of breast cancer. Additionally, it has shown potential as a therapeutic agent for targeting specific growth factors, such as glucagon and fatty acid receptors. This antibody exhibits cytotoxic properties and can inhibit the growth of cancer cells by blocking essential cellular processes. Furthermore, the SP1 antibody has been utilized in studies involving glutamate receptors and has proven to be valuable in understanding their functions. Overall, this highly specialized antibody offers great potential for researchers seeking to investigate various biological pathways and targets within the human body.

The PRMT5 antibody is a highly effective inhibitor that specifically targets protein kinase activity. This monoclonal antibody has been extensively tested and validated by Life Sciences experts to ensure its efficacy. It can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.

ZNF44 antibody was raised in mouse using recombinant Human Zinc Finger Protein 44 (Znf44)

The STIP1 antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). It can be used in immunoassays to detect and quantify GFAP in various biological samples. This antibody specifically recognizes the amino group of GFAP, allowing for accurate and sensitive detection. The STIP1 antibody has been extensively validated and is widely used in life sciences research. It is commonly used in studies involving epidermal growth factor (EGF) signaling pathways, as well as in the development of anti-HER2 antibodies. With its high specificity and sensitivity, this antibody offers researchers a valuable tool for studying GFAP-related processes and diseases.

Rat monoclonal Toll-like receptor 9 antibody (PE)

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.