Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
QSOX1 antibody
The QSOX1 antibody is a monoclonal antibody that plays a crucial role in neutralizing the growth factor and steroid histidine. It is widely used in Life Sciences for its ability to target and bind to specific antigens, facilitating various research applications. This high-quality antibody is produced through hybridization techniques, ensuring its specificity and efficacy. The QSOX1 antibody has shown promising results in studies related to enzastaurin, dopamine, and natriuretic factors. It can also be utilized for the detection of autoantibodies and antigen-antibody reactions. With its exceptional binding capabilities, this monoclonal antibody is an invaluable tool for researchers in the field of Life Sciences.
DUSP3 antibody
The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.
Goat anti Rabbit IgG (H+L) (PolyCompHRP)
Goat anti-Rabbit IgG (H+L) secondary antibody (PolyCompHRP); 1 mg/mlPurity:Min. 95%Epor antibody
Epor antibody was raised in rabbit using the N terminal of Epor as the immunogen
Purity:Min. 95%PTGES antibody
PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Chlamydia trachomatis antibody
Chlamydia trachomatis antibody was raised in goat using L2 and other serovar groups as the immunogen.Purity:Min. 95%ADRA2A antibody
The ADRA2A antibody is a powerful tool used in Life Sciences research. It specifically targets the ADRA2A protein, which plays a crucial role in various physiological processes such as influenza hemagglutinin binding and glucose-6-phosphate metabolism. This antibody has been extensively studied and validated for its specificity and sensitivity.
ZNF454 antibody
ZNF454 antibody was raised in rabbit using the N terminal of ZNF454 as the immunogenPurity:Min. 95%FER antibody
The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.
CDK7 antibody
CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen
Purity:Min. 95%RPA70 antibody
The RPA70 antibody is a highly specific reagent used in scientific research for various applications. It is commonly used in polymerase chain reactions (PCR) and immunohistochemical detection to study protein-protein interactions and cellular processes. This polyclonal antibody recognizes the RPA70 protein, which plays a crucial role in DNA replication and repair.
HS3ST6 antibody
HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP
CD122 antibody (Azide Free)
CD122 antibody (Azide free) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.
Purity:Min. 95%A2M antibody
The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.
Purity:Min. 95%HEY1 antibody
HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG
Purity:Min. 95%Myoglobin antibody
Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
STEAP3 antibody
STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
Purity:Min. 95%Goat anti Mouse IgM (mu chain) (HRP)
This antibody reacts with heavy (mu) chains on mouse IgM and light chains on all mouse immunoglobulins.Purity:Min. 95%GATA4 antibody
The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.
Fibrinopeptide A antibody (HRP)
Fibrinopeptide A antibody (HRP) was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.
APC antibody
The APC antibody is a monoclonal antibody that targets the endogenous hematopoietic growth factor known as insulin. This antibody specifically binds to the activated form of APC (activated protein C), which plays a crucial role in anticoagulant and anti-inflammatory processes. The APC antibody has been extensively studied in various life sciences research areas, including cancer biology and angiogenesis. It has shown promising results as an anti-VEGF (vascular endothelial growth factor) therapy, inhibiting the growth of blood vessels and tumor cells. This molecule drug has also been tested in human serum samples, demonstrating its potential clinical applications. In addition to its therapeutic use, polyclonal antibodies targeting APC have been developed for diagnostic purposes in various diseases and disorders.
Glucocorticoid Receptor beta antibody
Affinity purified Rabbit polyclonal Glucocorticoid Receptor beta antibody
cFos antibody
The cFos antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the cFos protein. This protein plays a crucial role in cellular growth and development, as well as in the regulation of various biological processes. By binding to the cFos protein, this antibody effectively inhibits its activity and prevents it from carrying out its normal functions.TCP10 antibody
TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
