Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Desmin antibody
The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.
Rabbit anti Mouse IgM
Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientificPurity:Min. 95%SERPINE1 antibody
SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMPurity:Min. 95%MEPE antibody
MEPE antibody was raised in rabbit using the middle region of MEPE as the immunogen
Purity:Min. 95%TIPIN antibody
TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen
Purity:Min. 95%Transferrin Receptor antibody
The Transferrin Receptor antibody is a monoclonal antibody that specifically targets the transferrin receptor, which is involved in the uptake of iron into cells. This antibody has been extensively studied in various fields of life sciences and has shown promising results. It has been used in adipose tissue research to study the role of transferrin in growth factor signaling pathways. In low-molecular-weight toxicity studies, this antibody has been found to be safe and well-tolerated.RTN4 antibody
RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
Purity:Min. 95%ApoC-I antibody
ApoC-I antibody was raised in goat using full-length recombinant apolipoprotein type C-I produced as the immunogen.Purity:Min. 95%Streptococcus Group A antibody
Streptococcus group A antibody was raised in rabbit using group A Streptococci as the immunogen.
Purity:Min. 95%FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
UBE1 antibody
The UBE1 antibody is a highly specialized antibody that targets the ubiquitin-activating enzyme 1 (UBE1). This enzyme plays a crucial role in the process of protein degradation by attaching ubiquitin molecules to target proteins. The UBE1 antibody specifically recognizes and binds to UBE1, inhibiting its activity and preventing the degradation of target proteins.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
BIK antibody
The BIK antibody is a monoclonal antibody that targets the epidermal growth factor receptor (EGFR) pathway. It is commonly used in life sciences research to study EGFR signaling and its role in various cellular processes. The BIK antibody specifically binds to activated EGFR, inhibiting its downstream signaling and preventing cell growth and proliferation. This antibody has also been shown to have anti-CD20 activity, making it a useful tool for studying B-cell biology. Additionally, the BIK antibody can be used in immunohistochemistry and Western blotting techniques to detect the presence of EGFR in tissue samples. Its high specificity and sensitivity make it an excellent choice for researchers studying the role of EGFR in cancer, development, and other biological processes.
DUSP3 antibody
The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.
Netrin 1 antibody
Netrin 1 antibody is a growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets netrin 1, a protein involved in cell migration and axon guidance. This antibody can be used for various applications, including research in the life sciences field.
Goat anti Rat IgG (H + L)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.
Purity:Min. 95%MVD antibody
The MVD antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed using cutting-edge technology. This antibody specifically targets and binds to collagen, making it an essential tool for research and diagnostic purposes.
Mad2L1 antibody
Mad2L1 antibody is a highly specific monoclonal antibody that targets Mad2L1 protein. Mad2L1 is involved in various cellular processes, including cell cycle regulation and checkpoint control. This antibody can be used for research purposes in the field of Life Sciences to study the role of Mad2L1 in different biological pathways.
REX1 antibody
The REX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of cryptosporidium parvum, a parasitic protozoan that causes gastrointestinal infections. The REX1 antibody can be used in immunoassays to identify and quantify the levels of cryptosporidium parvum in samples.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
