Primary Antibodies

Rat monoclonal RAE1g antibody (biotin)

Rabbit polyclonal TR19L antibody

Rabbit polyclonal SPR1 antibody

Goat anti-human lambda chain (Fab'2) was raised in goat using human l (lambda) light chain as the immunogen.

ZAP70 antibody was raised in rabbit using the N terminal of ZAP70 as the immunogen

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.

The GHRH Receptor antibody is a specific antibody that targets the growth hormone-releasing hormone (GHRH) receptor. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown to have neutralizing effects on the GHRH receptor, inhibiting its activity and downstream signaling pathways.

Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.

6-Fluoro-3-indoxyl-beta-D-galactopyranoside:

PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Rabbit polyclonal PSMB9 antibody

Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.

WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.

DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

The RAF1 antibody is a monoclonal antibody that specifically targets elastase, an enzyme involved in the breakdown of proteins. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody can be used to detect elastase levels in various biological samples, including human serum. Additionally, it has been shown to have potential therapeutic applications, such as inhibiting the action of elastase in conditions like pancreatitis or chronic obstructive pulmonary disease (COPD). The RAF1 antibody can also be used in combination with other antibodies, such as insulin or anti-VEGF antibodies, to study the interactions between different growth factors and signaling pathways. Its versatility and specificity make it a valuable tool for scientists and researchers working in diverse areas of biomedical research.

The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.

NCKIPSD antibody was raised in Rabbit using Human NCKIPSD as the immunogen

The STAT3 antibody is a monoclonal antibody that specifically targets the cytokine family. It has been extensively studied and validated using mass spectroscopy techniques in Life Sciences research. This antibody is designed to detect activated STAT3 in nuclear extracts, making it an essential tool for studying signaling pathways involving this transcription factor. The STAT3 antibody has been used in various applications such as chromatin immunoprecipitation assays to investigate its DNA binding activity and its role in gene regulation. Additionally, this antibody has shown anti-thrombotic properties and has been implicated in oxygen therapy research. Whether you're conducting basic research or exploring therapeutic avenues, the STAT3 antibody is a valuable tool for your studies. Choose from our range of high-quality monoclonal and polyclonal antibodies to meet your specific research needs.

ASNA1 antibody was raised in rabbit using the C terminal of ASNA1 as the immunogen

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

The RANKL antibody is a monoclonal antibody that targets the receptor activator of nuclear factor-kappa B ligand (RANKL). It is used in the field of life sciences to study various biological processes, including microvessel density and growth factor signaling. The RANKL antibody has been shown to have an acidic pH optimum and can be used in combination with other antibodies such as adalimumab or anticoagulants for research purposes. This antibody is commonly used in immunohistochemistry and Western blotting techniques to detect the presence of RANKL in different tissues or cell types. It has also been used in studies investigating the role of RANKL in diseases such as osteoporosis, cancer, and multidrug resistance.

Purified Polyclonal AKAP10 antibody

Rabbit polyclonal URM1 antibody

SPSB2 antibody was raised in rabbit using the N terminal of SPSB2 as the immunogen

Androgen receptor antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) E V Q L G L G R V Y P R P P S K T Y R G(21) C of human androgen receptor as the immunogen.

MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.

Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.

BD1 antibody was raised in rabbit using highly pure recombinant human BD-1 as the immunogen.

Rabbit polyclonal BUD31 antibody

Rabbit polyclonal PNRC2 antibody

Rabbit polyclonal NUDT19 antibody

ARSA antibody was raised in Rabbit using Human ARSA as the immunogen

Mouse monoclonal PGAM2 antibody

DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen

The HES1 antibody is a potent medicament that belongs to the class of antibodies. It specifically targets and neutralizes the activity of interferon-gamma (IFN-gamma), a growth factor involved in various cellular processes. This monoclonal antibody has been shown to inhibit the expression and function of urokinase plasminogen activator (uPA), which is responsible for thrombocytopenia and other clotting disorders. Additionally, the HES1 antibody has cytotoxic effects on cells expressing alpha-fetoprotein, a marker commonly found in certain types of cancer. Through its binding to the plasminogen activator receptor, this antibody disrupts signal transduction pathways involving tyrosine kinases, leading to impaired cell proliferation and survival. The HES1 antibody is widely used in Life Sciences research for its ability to modulate immune responses and investigate IFN-gamma-related diseases.

Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.

Zfp472 antibody was raised in rabbit using the N terminal of Zfp472 as the immunogen

PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Rabbit polyclonal RPA2 antibody (FITC)

IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.