Primary Antibodies

Rabbit polyclonal ARPC3 antibody (biotin)

Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.

ARPC4 antibody was raised in Rabbit using Human ARPC4 as the immunogen

ARSA antibody was raised in Rabbit using Human ARSA as the immunogen

Mouse monoclonal RNPEP antibody

Rabbit Polyclonal Tau antibody (Thr181)

The RANKL antibody is a monoclonal antibody that targets the receptor activator of nuclear factor-kappa B ligand (RANKL). It is used in the field of life sciences to study various biological processes, including microvessel density and growth factor signaling. The RANKL antibody has been shown to have an acidic pH optimum and can be used in combination with other antibodies such as adalimumab or anticoagulants for research purposes. This antibody is commonly used in immunohistochemistry and Western blotting techniques to detect the presence of RANKL in different tissues or cell types. It has also been used in studies investigating the role of RANKL in diseases such as osteoporosis, cancer, and multidrug resistance.

HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.

Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.

PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.

Rabbit polyclonal PSMB7 antibody

The HCG beta Antibody is a specific monoclonal antibody that is commonly used in Life Sciences research. It has been extensively studied and proven to be highly effective in various applications. This antibody specifically targets the influenza hemagglutinin, which plays a crucial role in receptor binding and viral entry.

Rabbit Polyclonal BCL2L12 antibody

The C-peptide antibody is a monoclonal antibody that is used for various applications in medical research and diagnostics. It is designed to specifically target and bind to the C-peptide, a peptide released during the processing of proinsulin into insulin. This antibody has been extensively characterized and validated for its high specificity and sensitivity.

The APP antibody is a high-quality polyclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and detect amyloid precursor protein (APP), a key player in the formation of amyloid plaques associated with Alzheimer's disease.

Mouse monoclonal HVEM antibody (PE)

Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Rabbit polyclonal STATH antibody

The ALPK1 antibody is a highly specific monoclonal antibody that targets the ALPK1 protein. This protein plays a crucial role in various cellular processes, including oncostatin signaling and β-catenin activation. The ALPK1 antibody has been extensively tested and validated for its specificity, ensuring accurate and reliable results in experiments.

SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

Donkey anti-guinea pig IgG (H + L) (Cy3) was raised in donkey using guinea pig IgG (H & L) as the immunogen.

Rabbit polyclonal TERF2IP antibody

Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.

Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.

Rabbit polyclonal PLA2G4F antibody

The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.

Rabbit polyclonal PDCL2 antibody

The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.

The CYP1A1 antibody is a highly specific antibody that targets the cytochrome P450 1A1 enzyme. This enzyme plays a crucial role in the metabolism of various drugs and toxins in the body. The CYP1A1 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). It has been extensively validated for its specificity and sensitivity.

Rabbit polyclonal argF antibody (HRP)

The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.

DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen

Rabbit polyclonal 14-3-3 zeta/theta antibody

The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.

Mouse monoclonal MAPK1 antibody

The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.

CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.

The PYK2 antibody is a highly specific monoclonal antibody that targets PYK2, a tyrosine kinase protein involved in various cellular processes. This antibody has been extensively tested and validated for its ability to neutralize the activity of PYK2, making it an invaluable tool for researchers studying signal transduction pathways and cell signaling mechanisms. The PYK2 antibody can be used in a variety of applications, including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry. It is available as both a purified monoclonal antibody and as part of a kit that includes all the necessary reagents for successful experiments. With its high specificity and sensitivity, the PYK2 antibody is an essential tool for any researcher working with PYK2-related studies.

Rabbit polyclonal AP2S1 antibody (FITC)

Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.

HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.