Primary Antibodies

Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.

Rabbit polyclonal STOML3 antibody

Mouse monoclonal HVEM antibody (PE)

Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.

Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.

ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL

The CTNNB1 antibody is a monoclonal antibody that specifically targets the CTNNB1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion, signal transduction, and gene expression. The CTNNB1 antibody has been extensively studied and shown to be highly specific and sensitive in detecting CTNNB1 in various biological samples.

PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

Purified Rabbit polyclonal EPHA4 antibody (Tyr596)

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

OR6C70 antibody was raised using the C terminal of OR6C70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK

The TFE3 antibody is a monoclonal antibody that specifically targets CD33, an antigen expressed on the surface of certain cells. It belongs to the class of anti-CD33 antibodies and is widely used in life sciences research. The TFE3 antibody has been shown to bind to CD33 with high affinity, effectively blocking receptor binding and modulating downstream signaling pathways. This antibody can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting. Additionally, the TFE3 antibody has been used in studies investigating autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Its ability to neutralize TNF-α and inhibit the activation of immune cells makes it a valuable tool in immunology research. Furthermore, this antibody has shown potential therapeutic effects in preclinical models of cancer by targeting CD33-expressing tumor cells. With its versatility and wide range of applications, the TFE3 antibody is an essential tool for

Goat anti-human IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.

The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.

The STT3B antibody is a powerful tool in the field of Life Sciences. It is widely used in research and diagnostic applications due to its high specificity and sensitivity. This antibody has been extensively tested and proven to be effective in various experiments.

The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.

Rabbit polyclonal DOK7 antibody

TSH beta antibody was raised against Human TSH (intact).

Sheep polyclonal Azaperone antibody

ART3 antibody was raised in Rabbit using Human ART3 as the immunogen

Mouse monoclonal alpha Tubulin antibody (biotin)

IL1 alpha antibody was raised in rabbit using highly pure recombinant human IL-1a as the immunogen.

The HES1 antibody is a potent medicament that belongs to the class of antibodies. It specifically targets and neutralizes the activity of interferon-gamma (IFN-gamma), a growth factor involved in various cellular processes. This monoclonal antibody has been shown to inhibit the expression and function of urokinase plasminogen activator (uPA), which is responsible for thrombocytopenia and other clotting disorders. Additionally, the HES1 antibody has cytotoxic effects on cells expressing alpha-fetoprotein, a marker commonly found in certain types of cancer. Through its binding to the plasminogen activator receptor, this antibody disrupts signal transduction pathways involving tyrosine kinases, leading to impaired cell proliferation and survival. The HES1 antibody is widely used in Life Sciences research for its ability to modulate immune responses and investigate IFN-gamma-related diseases.

Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.

The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.

Rabbit polyclonal IP6K3 antibody

The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.

PSENEN antibody was raised in rabbit using the C terminal of PSENEN as the immunogen

FGFR4 antibody was raised in Rabbit using Human FGFR4 as the immunogen

The AMPD1 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets and detects AMPD1, an enzyme involved in fatty acid metabolism. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.

OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen

Purified Rabbit polyclonal MKK10-2 antibody

MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS

Rabbit polyclonal BDNF antibody (HRP)

APOBEC3C antibody was raised in Rabbit using Human APOBEC3C as the immunogen

The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the

The PRDX6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the protein peroxiredoxin 6 (PRDX6), which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research involving cholinergic signaling, electrode development, and protein kinase studies.

AGTRAP antibody was raised in Rabbit using Human AGTRAP as the immunogen

The eIF2 alpha antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the protein eIF2 alpha, which plays a crucial role in cellular processes such as translation initiation. By blocking the activity of eIF2 alpha, this antibody can be used to study its function and regulation in various biological systems.

Rabbit polyclonal Stathmin 1 antibody (Ser37)

The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.