Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Fibrinopeptide A antibody
Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.
SMAD2 antibody
The SMAD2 antibody is a highly specialized Monoclonal Antibody that targets the EGF-like domain of the SMAD2 protein. It is widely used in research and bioassays to study the role of SMAD2 in various cellular processes. This antibody specifically recognizes the glial fibrillary acidic protein (GFAP), a key marker for astrocytes and reactive gliosis. It has been shown to have neutralizing activity against GFAP, making it an effective tool for studying the functions and regulation of this important glycoprotein.
CD152 antibody (Azide Free)
CD152 antibody (Azide free) was raised in hamster using murine CD152/CTLA-4 as the immunogen.
Purity:Min. 95%Integrin Beta 5 antibody
Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALPurity:Min. 95%RLBP1L1 antibody
RLBP1L1 antibody was raised using the middle region of RLBP1L1 corresponding to a region with amino acids MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT
PSA antibody
The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.
LIPT1 antibody
LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
PPP1R15A antibody
The PPP1R15A antibody is a highly specific monoclonal antibody that targets the protein PPP1R15A. This protein plays a crucial role in cellular processes such as collagen synthesis and response to oncostatin. The antibody has been extensively tested and validated for its specificity and sensitivity.
NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
GADD45A antibody
GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen
SEPN1 antibody
SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen
Purity:Min. 95%SEPP1 antibody
SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
DPPA5 antibody
DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
Mcm7 antibody
The Mcm7 antibody is a cytotoxic monoclonal antibody that belongs to the category of Life Sciences products. It has been specifically designed to target and neutralize the activated form of Mcm7, an inhibitory factor involved in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit the activity of interleukin-6, a hormone peptide involved in inflammatory responses. Additionally, it has been found to interact with cholinergic receptors and exhibit inhibitory effects on liver microsomes. The Mcm7 antibody is a highly specialized tool for researchers in the field of Life Sciences who are studying the role of Mcm7 in cellular processes and its potential as a therapeutic target.
Gabrp antibody
Gabrp antibody was raised in rabbit using the N terminal of Gabrp as the immunogen
Purity:Min. 95%ORM2 antibody
The ORM2 antibody is a highly specialized monoclonal antibody that is used in various applications within the field of life sciences. This antibody specifically targets and reacts with the ORM2 protein, which is found in blood plasma and plays a crucial role in transporting fatty acids. The ORM2 antibody can be used in assays such as double-label immunofluorescence to detect the presence and localization of ORM2 protein in different cell types or tissues. It has also been utilized in studies involving pluripotent stem cells, where it helps identify specific markers such as neuronspecific enolase. With its high specificity and affinity, the ORM2 antibody provides researchers with a valuable tool for investigating the functions and interactions of this important protein.
SHARPIN antibody
SHARPIN antibody was raised in rabbit using the C terminal of SHARPIN as the immunogen
Purity:Min. 95%SARS-CoV-2 Spike Antibody
The SARS-CoV-2 Spike Antibody is a highly effective tool for immunoassays and research in the field of Life Sciences. This antibody specifically targets the spike protein of the SARS-CoV-2 virus, which is responsible for receptor binding and entry into host cells.Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
GLP1 antibody
The GLP1 antibody is a monoclonal antibody that acts as an immunosuppressant. It targets specific molecules such as alpha-fetoprotein, calmodulin, and angptl3, inhibiting their activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the effects of these molecules. Additionally, it has been found to have an inhibitory effect on phosphatase activity. The GLP1 antibody can be used in various applications, including research studies and therapeutic interventions. Its unique properties make it a valuable tool for investigating adipose tissue biology, colloidal chemistry, chemokine signaling pathways, and human serum analysis. With its high specificity and efficacy, this antibody is an essential component for any laboratory or research facility looking to advance their understanding of these biological processes.Cofilin antibody
The Cofilin antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing chemokines, interferons, and growth factors that are activated and reactive in the body. This antibody has been shown to inhibit the activity of 3-kinase enzymes, which play a crucial role in cell growth and proliferation. Additionally, it can also bind to autoantibodies and taxol, preventing their harmful effects on the body. The Cofilin antibody has been extensively studied for its potential therapeutic applications in various diseases and conditions.
Purity:Min. 95%MHC class II antibody
The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.
Rabbit anti Mouse IgM
Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific
Purity:Min. 95%
