Primary Antibodies

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>Rabbit polyclonal PDCD1 antibody</p>

<p>The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>LSM4 antibody was raised in Rabbit using Human LSM4 as the immunogen</p>

<p>The SSRP1 antibody is a highly potent growth factor that acts as a phosphatase in various bioassays. It is specifically activated by human serum and has neutralizing properties. This antibody, widely used in Life Sciences research, targets tyrosine kinase receptors and 3-kinases to regulate cellular processes. It can be utilized in electrode-based experiments and is commonly employed in the field of Antibodies research. Additionally, the SSRP1 antibody has been found to exhibit genotoxic effects and shows potential as an anti-beta amyloid agent for combating amyloid protein-related disorders.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Rabbit polyclonal APBB1IP antibody</p>

<p>The TFCP2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the transcription factor CP2 (TFCP2) and is commonly used to study its role in various cellular processes. This antibody has been shown to effectively detect TFCP2 in different experimental settings, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>